Skip to Content
Merck
CN

HPA003157

Anti-BGN antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Biglycan precursor antibody produced in rabbit, Anti-Bone/cartilage proteoglycan I antibody produced in rabbit, Anti-PG-S1 antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
13
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BGN(633)

General description

BGN (biglycan), also called proteoglycan I (PGI), which belongs to the family of proteoglycans called small leucine-rich proteoglycan (SLRP). This protein is composed of characteristic leucine-rich repeat motifs located centrally. These motifs are linked by disulfide bond stabilized loops. It is predominantly expressed in tissues of mesenchymal type, and is found in the cell surface or in the pericellular matrix.

Immunogen

Biglycan precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-BGN antibody produced in rabbit is suitable for use in measuring the concentration of biglycan by sandwich ELISA method.
Anti-BGN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

BGN (biglycan) gene encodes a leucine-rich, pericellular matrix proteoglycan that functions in the assembly of collagen fibrils and muscle regeneration. It belongs to the decorin family of proteins and contains two chains of chondroitin sulfate. It interacts with transforming growth factor β and may function in regulating its activities. The distribution of this protein indicates that it may be involved in the physiology of the neuromuscular junction, and morphogenesis and differentiation of tissues. The protein functions as an endogenous ligand for Toll-like receptors, TLR4 and TLR2, that are involved in innate immunity. It enhances inflammation via TLR4 and TLR2 signaling, leading to the synthesis of TNF-α (Tumor necrosis factor-α) and MIP-2 (macrophage inflammatory protein-2).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74436

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
常规特殊物品
低风险生物材料

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Articles

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.


Vida Kocbek et al.
Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology, 30(7), 520-524 (2014-03-20)
In our previous low-density-array gene-expression analysis we found an increased expression of biglycan gene in ovarian endometriosis patients. In the present study we evaluated biglycan expression at the protein level in tissue, serum and peritoneal fluid (PF) from ovarian endometriosis
Ying-Hui Zhu et al.
International journal of clinical and experimental pathology, 6(11), 2497-2505 (2013-11-15)
Biglycan (BGN), an extracellular matrix component, has been reported to play a crucial role in the tumor progression of various cancers. However, the relation between the expression of BGN and clinical prognosis has not been studied yet. We therefore carry
Frank Jacobsen et al.
Neoplasia (New York, N.Y.), 19(9), 707-715 (2017-08-23)
Biglycan (BGN), a proteoglycan of the extracellular matrix, is included in mRNA signatures for prostate cancer aggressiveness. To understand the impact of BGN on prognosis and its relationship to molecularly defined subsets, we analyzed BGN expression by immunohistochemistry on a



Global Trade Item Number

SKUGTIN
HPA003157-25UL04061842812899
HPA003157-100UL04061837123399