Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
5
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:50-1:200
immunogen sequence
QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL17RB(55540)
General description
Interleukin 17 receptor B (IL17RB) is a member of the IL-17 receptor (IL17R) family. It makes a heterodimeric receptor complex along with IL17RA. This family of proteins has a single transmembrane domain, which contains fibronectin type-III (FnIII) domain. They have an extracellular domain and a cytosolic domain which contains the unique SEFIR [SEF (similar expression to fibroblast growth factor genes) and IL-17R] domain. IL17RB acts as a receptor for IL17B as well as IL17E. In humans, this gene is located on chromosome 3p21.1. The molecular weight of IL17RB is 56kDa. It is expressed on lung fibroblasts, basophils along with CD4+ Th2 memory cells.
Immunogen
Interleukin-17 receptor B precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-IL17RB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
Interleukin 17 receptor B (IL17RB) expression is induced by Th2 cytokines, in antigen presenting cells. Induction of IL17RB leads to inflammatory responses via activation of Jun kinase (JNK), nuclear factor-κB and p38 mitogen-activated protein kinase (MAPK). Therefore, polymorphisms in this gene are associated with asthma, and can be used as markers to determine the risk of developing asthma. Studies suggest that IL17RB is the only gene, whose transcription varies in accordance with the IgE levels in asthmatics. Exposure to natural allergens leads to elevated levels of IL17RB in patients with seasonal allergic rhinitis (SAR). Blocking of this protein prevents lung inflammation and thus, IL17RB can be a potential therapeutic target for allergies.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST86465
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Upregulation of IL17RB during natural allergen exposure in patients with seasonal allergic rhinitis.
Yuri Matsumoto et al.
Allergology international : official journal of the Japanese Society of Allergology, 60(1), 87-92 (2011-01-22)
Seasonal allergic rhinitis (SAR) to Japanese cedar (Cryptomeria japonica; JC) is an IgE-mediated type I allergy affecting the nasal mucosa. However, the molecular mechanisms that underlie SAR are only partially understood. The aim of the study was to identify novel
Bing Zhang et al.
Journal of immunology (Baltimore, Md. : 1950), 190(5), 2320-2326 (2013-01-29)
IL-17 cytokines play a crucial role in a variety of inflammatory and autoimmune diseases. They signal through heterodimeric receptor complexes consisting of members of IL-17R family. A unique intracellular signaling domain was identified within all IL-17Rs, termed similar expression to
Ji-Sun Jung et al.
Chest, 135(5), 1173-1180 (2009-01-02)
Interleukin (IL)-17E is a member of the IL-17 family, which induces IL-4, IL-5, IL-13, and eotaxin in experimental animals via IL-17 receptor B (IL-17RB). The activation of IL-17RB amplifies allergic-type inflammatory responses by inducing Jun kinase (or JNK), p38 mitogen-activated
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA005482-100UL | 04061837135736 |