Skip to Content
Merck
CN

HPA014699

Anti-SCAMP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Secretory carrier membrane protein 2, Anti-Secretory carrier-associated membrane protein 2

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
7
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

DPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... SCAMP2(10066)

Looking for similar products? Visit Product Comparison Guide

General description

SCAMP2 (secretory carrier membrane protein 2) belongs to the SCAMP family of highly conserved integral membrane proteins, which are involved in cell surface recycling pathways). SCAMP2 is one of the two isoforms of SCAMP, the other being SCAMP1, and has a molecular weight of 39kDa. It has a wide range of tissue expression. It is a transmembrane protein, which contains a cytoplasmic N-terminal, cytoplasmic C-terminal tail and four transmembrane regions. It contains NHE5 (Na+/H+ exchanger)-binding sites in both its N- and C-termini. It also contains the characteristic E-peptide of SCAMP proteins, within the second and third transmembrane helices. This protein resides in endosomes, other recycling organelles, as well as plasma membrane.

Immunogen

Secretory carrier-associated membrane protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SCAMP2 (secretory carrier membrane protein 2) is involved in Ca2+-dependent granule exocytosis, and is a part of the later stages of membrane fusion. It controls the formation of membrane fusion pores, by sequestering phosphatidylinositol 4,5-bisphosphate (PIP2) within membranes. It interacts with PIP2 via a hydrophobic sequence CWYRPIYKAFR, present in its structure. It interacts with serotonin and dopamine transporters, and controls their subcellular distribution and their surface expression. It interacts with NHE5, which is a Na+/H+ exchanger highly expressed in brain, through its cytoplasmic N- and C-termini. This way, it regulates the movement of NHE5 through recycling endosomes, and its cell surface targeting, in the presence of Arf6 (ADP-ribosylation factor 6). The E-peptide of SCAMP2 protein is a potent inhibitor of exocytosis during the later stages.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73121

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lixia Liu et al.
Molecular biology of the cell, 13(12), 4266-4278 (2002-12-12)
In secretory carrier membrane proteins (SCAMPs), the most conserved structural segment is between transmembrane spans 2 and 3, facing the cytosol. A synthetic peptide, CWYRPIYKAFR (E peptide), from this segment of SCAMP2 potently inhibits exocytosis in permeabilized neuroendocrine (PC12) cells.
Haini Liao et al.
Biochemistry, 46(38), 10909-10920 (2007-08-24)
Secretory carrier membrane protein 2 (SCAMP2) functions in late steps of membrane fusion in calcium-dependent granule exocytosis. A basic/hydrophobic peptide segment within SCAMP2 (SCAMP2 E: CWYRPIYKAFR) has been implicated in this function and shown to bind and sequester phosphatidylinositol 4,5-bisphosphate
Heidi Kaastrup Müller et al.
The Journal of biological chemistry, 281(39), 28901-28909 (2006-07-28)
The serotonin transporter (SERT) belongs to the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters responsible for uptake of amino acids and biogenic amines from extracellular spaces. Their activities and subcellular distributions are regulated by various cellular mechanisms, including interactions
T T Wu et al.
Journal of cell science, 110 ( Pt 13), 1533-1541 (1997-07-01)
Secretory carrier membrane proteins (SCAMPs) are proteins of post-Golgi recycling carriers, including regulated secretory organelles. The two major size variants, SCAMP1 (37 kDa) and SCAMP2 (39 kDa), extensively colocalize in membranes of fibroblasts and parotid acinar cells based on immunocytochemistry
Graham H Diering et al.
The Journal of biological chemistry, 284(20), 13892-13903 (2009-03-12)
NHE5 is a brain-enriched Na(+)/H(+) exchanger that dynamically shuttles between the plasma membrane and recycling endosomes, serving as a mechanism that acutely controls the local pH environment. In the current study we show that secretory carrier membrane proteins (SCAMPs), a

Related Content

Prestige Antibodies Immunofluorescence Procedure

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service