Skip to Content
Merck
CN

HPA014740

Anti-KCNC4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-KSHIIIC, Anti-Potassium voltage-gated channel subfamily C member 4, Anti-Voltage-gated potassium channel subunit Kv34

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF
Citations:
6
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KCNC4(3749)

General description

KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4) is an A-type K+ channel, and is also called Kv3.4. Its inactivation gate is made by the first 28 amino acids present in the N-terminal. This inactivation sequence also contains four predicted protein kinase C (PKC) phosphorylation sites. It is expressed in muscle, spinal cord, dorsal root ganglia, mossy fiber neurons and Purkinje neurons.

Immunogen

Potassium voltage-gated channel subfamily C member 4 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4) is suppressed by protein kinase C by N-type inactivation, in dorsal root ganglia neurons. This results in regulation of the duration of action potential, as well as the rate of repolarization. Any aberration leads to loss of homeostasis, which is seen in chronic pain conditions post spinal cord injury. Ionizing radiation leads to the activation of this channel, which results in cell cycle arrest in G2/M phase, as seen in irradiated leukemia cells. This channel is up-regulated in head and neck squamous cell carcinomas, where it facilitates tumorigenesis and malignancy. In vitro studies show that under the influence of estrogen, KCNC4 regulates the development and remodeling of arteries in human uterus, during pregnancy. It is up-regulated in early stages of Alzheimer′s disease (AD), and is found highly abundant at later stages of the disease, in neurodegenerative regions.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73041

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



E J Beck et al.
The Journal of general physiology, 112(1), 71-84 (1998-07-03)
Protein kinase C inhibits inactivation gating of Kv3.4 K+ channels, and at least two NH2-terminal serines (S15 and S21) appeared involved in this interaction (. Neuron. 13:1403-1412). Here we have investigated the molecular mechanism of this regulatory process. Site-directed mutagenesis
Ester Angulo et al.
Journal of neurochemistry, 91(3), 547-557 (2004-10-16)
Gene expression throughout the different stages of Alzheimer's disease was analysed in samples from cerebral cortex. The gene encoding the voltage-gated potassium channel Kv3.4 was already overexpressed in early stages of the disease, and in advanced stages Kv3.4 was present
Daniela Palme et al.
Pflugers Archiv : European journal of physiology, 465(8), 1209-1221 (2013-02-28)
Aberrant ion channel expression in the plasma membrane is characteristic for many tumor entities and has been attributed to neoplastic transformation, tumor progression, metastasis, and therapy resistance. The present study aimed to define the function of these "oncogenic" channels for



Global Trade Item Number

SKUGTIN
HPA014740-100UL04061835680597
HPA014740-25UL04061842804016