Skip to Content
Merck
CN

HPA015515

Anti-MAPKAPK5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-MAP kinase-activated protein kinase 5, Anti-MAPK-activated protein kinase 5, Anti-MAPKAP kinase 5, Anti-p38-regulated/activated protein kinase

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
5
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... MAPKAPK5(8550)

Looking for similar products? Visit Product Comparison Guide

General description

MAPKAPK5 (mitogen-activated protein kinase-activated protein kinase 5) is a Ser/Thr kinase, which belongs to a family of MAPK-phosphorylated kinases called MAPKAPK. In humans, eleven such MAPKAPK exist, which are divided into four groups, and MAPKAPK5 belongs to the fourth group, along with MAPKAPK 2 and 3. It was initially recognized as p38 MAKP-activated protein, and is a protein composed of 471 amino acids. It has a ubiquitous expression pattern, and resides primarily in the cytoplasm. This protein shuttles between the cytoplasm and nucleus, and thus, supposedly contains both nuclear localization sequence (NLS) and nuclear export sequence (NES).

Immunogen

MAP kinase-activated protein kinase 5 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

MAPKAPK5 (mitogen-activated protein kinase-activated protein kinase 5) is acted upon by ERK (extracellular signal regulated kinase) 3, ERK4 and mitogen-activated protein kinases p38. It acts as a tumor suppressor gene or as an oncogene, and controls cell locomotion, cell cycle control, embryo development and anxiety. It is activated by the presence of microbial pathogen, to elicit an immune response. It is an interacting partner of DJ-1, which is a mitogen-dependent oncogene product. Induction of DJ-1 leads to the accumulation of Daxx in the nucleus, thereby preventing cell apoptosis under oxidative stress. It is involved in doxorubicin-resistance in hepatocellular carcinoma cells, where it is involved in suppressing doxorubicin-induced apoptosis. Doxorubicin also induces the degradation of this protein. This protein interacts with and phosphorylates heat shock protein 27 (Hsp27), which in turn mediates PKA (protein kinase A)-induced rearrangement of F-actin.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73480

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
低风险生物材料
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Inger Lindin et al.
International journal of molecular sciences, 15(3), 4878-4902 (2014-03-22)
The mitogen-activated protein kinase-activated protein kinase MK5 is a substrate of the mitogen-activated protein kinases p38, ERK3 and ERK4. Cell culture and animal studies have demonstrated that MK5 is involved in tumour suppression and promotion, embryogenesis, anxiety, cell motility and
Sergiy Kostenko et al.
Cellular signalling, 21(5), 712-718 (2009-01-27)
Mitogen-activated protein kinase (MAPK) pathways can play a role in F-actin dynamics. In particular, the p38 MAPK/MAPK-activated protein kinase 2 (MK2)/heat shock protein 27 (Hsp27) pathway is involved in F-actin alternations. Previously, we showed that MK5 is implicated in F-actin
Sreeram Vallabhaneni et al.
Molecular oncology, 16(5), 1184-1199 (2021-11-01)
ERK3, officially known as mitogen-activated protein kinase 6 (MAPK6), is a poorly studied mitogen-activated protein kinase (MAPK). Recent studies have revealed the upregulation of ERK3 expression in cancer and suggest an important role for ERK3 in promoting cancer cell growth
Jun Zhou et al.
Biochemical and biophysical research communications, 427(3), 581-586 (2012-10-02)
Hepatocellular carcinoma (HCC) is one of the most common malignant tumors worldwide. The mechanisms by which hepatoma cells resist apoptosis induced by doxorubicin are largely unknown. MAPKAPK5 (MK5), also named as p38-regulated/activated protein kinase (PRAK), has been identified as a
Jing Tang et al.
Oxidative medicine and cellular longevity, 2014, 735618-735618 (2014-11-11)
As a core member of p38 MAPK signal transduction pathway, p38 regulated/activated kinase (PRAK) is activated by cellular stresses. However, the function of PRAK and its downstream interacting partner remain undefined. Using a yeast two-hybrid system, we identified DJ-1 as

Related Content

Prestige Antibodies Immunofluorescence Procedure

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service