Skip to Content
Merck
CN

HPA023591

Anti-ZSCAN21 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Renal carcinoma antigen NY-REN-21, Anti-Zfp-38, Anti-Zinc finger and SCAN domain-containing protein 21, Anti-Zinc finger protein 38 homolog

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
ChIP
immunoblotting
immunohistochemistry
Species reactivity:
human
Citations:
4
Technique(s):
ChIP: 1—10 μg (per reaction)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
Uniprot accession no.:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-ZSCAN21 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

Quality Level

Gene Information

human ... ZSCAN21(7589)

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

ChIP: 1—10 μg (per reaction)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The gene ZSCAN21 (zinc finger and SCAN domain containing 21) encodes a transcription factor that transcriptionally regulates the gene SNCA that encodes α-synuclein in primary neuronal cultures. α-Synuclein is a presynaptic neuronal protein that is associated with Parkinson disease (PD). Therefore, the ZSCAN21 gene may serve as a potential target in the treatment of PD.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

The gene ZSCAN21 (zinc finger and SCAN domain containing 21), also referred to as NY-REN-21, encodes a C2H2 type multi-finger protein that contains an N-terminal SCAN (SRE-ZBP, CTfin51, AW-1 (ZNF174), and Number 18 cDNA or ZnF20) domain and a predicted coil at the central region. The SCAN domain has the ability to form homodimers.

Immunogen

Zinc finger and SCAN domain-containing protein 21 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST70967

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Spectroscopic characterization of the tumor antigen NY-REN-21 and identification of heterodimer formation with SCAND1.
Carneiro FR
Biochemical and Biophysical Research Communications, 343, 260-268 (2006)
Complex Effects of the ZSCAN21 Transcription Factor on Transcriptional Regulation of a-Synuclein in Primary Neuronal Cultures and in Vivo.
Dermentzaki G
The Journal of Biological Chemistry, 291, 8756-8772 (2016)
Iréna Lassot et al.
Cell reports, 25(9), 2484-2496 (2018-11-30)
Although accumulating data indicate that increased α-synuclein expression is crucial for Parkinson disease (PD), mechanisms regulating the transcription of its gene, SNCA, are largely unknown. Here, we describe a pathway regulating α-synuclein expression. Our data show that ZSCAN21 stimulates SNCA
Functional dissection of the alpha-synuclein promoter: transcriptional regulation by ZSCAN21 and ZNF219.
Clough RL
Journal of Neurochemistry, 110, 1479-1490 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service