Skip to Content
Merck
CN

HPA026817

Anti-PCDH17 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Protocadherin-17, Anti-Protocadherin-68

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
10
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... PCDH17(27253)

General description

The protocadherin 17 (PCDH17) gene, mapped to human chromosome 13q21.2, codes for a neuronal cell adhesion molecule, PCDH17. The encoded protein belongs to the cadherin superfamily and is predominantly expressed in focal regions of the human prefrontal cortex. PCDH17 is predominantly expressed in the exterior margins of the thalamus, ventromedial striatal neuroepithelium, and anterior cingulate.

Immunogen

Protocadherin-17 Precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-PCDH17 antibody produced in rabbit has been used in immunofluorescence staining. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Methylation of protocadherin 17 (PCDH17) in serum repeatedly at the initial stage of prostate cancer, can serve as potential marker for the biochemical recurrence (BCR) of prostate cancer after radical prostatectomy. Genistein up-regulates PCDH17 mRNA expression and facilitates gene promoter demethylation and cell cycle arrest in gastric cancer. The encoded protein acts as a tumor suppressor gene in NPC (nasopharyngeal carcinoma), colorectal cancer and esophageal squamous cell carcinoma (ESCC).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70119

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

低风险生物材料
常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Protocadherin 17 functions as a tumor suppressor suppressing Wnt/?-catenin signaling and cell metastasis and is frequently methylated in breast cancer.
Yin X
Oncotarget, 7(32), 51720-51732 (2016)
Xuedong Yin et al.
Oncotarget, 7(32), 51720-51732 (2016-06-29)
Protocadherins play important roles in the regulation of cell adhesion and signaling transduction. Aberrant expression of protocadherins has been shown to be associated with multiple tumorigenesis. We previously identified PCDH17, encoding protocadherin 17, as a frequently methylated and downregulated tumor
Frequent silencing of protocadherin 17, a candidate tumour suppressor for esophageal squamous cell carcinoma.
Haruki S
Carcinogenesis, 31(6), 1027-1036 (2010)
PCDH17 gene promoter demethylation and cell cycle arrest by genistein in gastric cancer.
Yang Y
Histology and Histopathology, 27(2), 217-224 null
Liuxi Chen et al.
Journal of Cancer, 10(25), 6207-6216 (2019-11-28)
Purpose: To determine whether p53, PCDH17, Beclin-1 expression is associated with clinicopathological characteristics of bladder cancer. Materials and Methods: 75 patients with non-muscle-invasive and muscle-invasive bladder cancer were included. Immunohistochemical staining for p53, PCDH17 and Beclin-1 were carried out on

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service