Skip to Content
Merck
CN

HPA048198

Anti-FAN1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Synonym(s):

KIAA1018, MTMR15

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF
Citations:
6
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

RFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... FAN1(22909)

General description

Fanconi-associated nuclease 1 (FAN1) encodes DNA repair nuclease, which is necessary for interstrand cross link DNA repair. The gene FAN1 is located on human chromosome 15q13.3.

Immunogen

FANCD2/FANCI-associated nuclease 1

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-FAN1 antibody recognises FAN1 protein.

Biochem/physiol Actions

Fanconi-associated nuclease 1 (FAN1) has 5′ flap endonuclease and 5′-3′ exonuclease activity. Mutations in FAN1 gene causes Fanconi anaemia, which is a bone marrow failure disorder, associated with chromosome fragility and vulnerability to cancer. Aberrations in FAN1 leads to improper DNA repair and causes psychiatric and neurodevelopmental disorders like schizophrenia and autism.(2) Mutations in FAN1 is linked to karyomegalic interstitial nephritis (KIN) in kidney. It is also related to hereditary colorectal cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST91131

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

KIAA1018/FAN1 nuclease protects cells against genomic instability induced by interstrand cross-linking agents
Yoshikiyo K, et al.
Proceedings of the National Academy of Sciences of the USA, 107(50), 21553-21557 (2010)
Scan statistic-based analysis of exome sequencing data identifies FAN1 at 15q13.3 as a susceptibility gene for schizophrenia and autism
Ionita-Laza I, et al.
Proceedings of the National Academy of Sciences of the USA, 111(1), 343-348 (2014)
Fanconi anemia: a model disease for studies on human genetics and advanced therapeutics
Bogliolo M and Surralles J
Current Opinion in Genetics & Development, 33(3), 32-40 (2015)
Germline mutations in FAN1 cause hereditary colorectal cancer by impairing DNA repair
Segu'i N, et al.
Gastroenterology, 149(3), 563-566 (2015)
FAN1 mutations cause karyomegalic interstitial nephritis, linking chronic kidney failure to defective DNA damage repair
Zhou W, et al.
Proceedings of the National Academy of Sciences of the USA, 44(8), 910-910 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service