Skip to Content
Merck
CN

SAB1408582

Anti-MCHR1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonym(s):

GPR24, MCH1R, MGC32129, SLC1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-MCHR1 antibody produced in rabbit, purified immunoglobulin, buffered aqueous solution

biological source

rabbit

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~46 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... MCHR1(2847)

Application

Anti-MCHR1 antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

MCHR1 (melanin-concentrating hormone receptor 1) is involved in various biological processes such as in regulation of energy balance, food intake, physical activity and body weight. It is majorly associated with the neurotransmitter and neuropeptide systems, which are a part of regulation of food intake and energy balance. It forms complex with G proteins to inhibit adenylyl cyclase and with G proteins that activate phosphoinositide hydrolysis. The gene is associated with the schizophrenia disease since it has influence on schizophrenia susceptibility. It mediates Gα(i)-dependent signaling pathway. It has also been reported that MCHR1 regulates the orexigenic activity of melanin-concentrating hormone (MCH).

General description

The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. (provided by RefSeq)

Immunogen

MCHR1 (AAH21146.1, 1 a.a. ~ 422 a.a) full-length human protein.

Sequence
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Carmit Goldstein et al.
The Journal of pharmacology and experimental therapeutics, 335(3), 799-806 (2010-09-14)
The melanin-concentrating hormone (MCH) receptor type 1 (MCHR1) is a seven-transmembrane domain protein that modulates orexigenic activity of MCH, the corresponding endogenous peptide agonist. MCH antagonists are being explored as a potential treatment for obesity. In the current study, we
Stefanie Stepanow et al.
PloS one, 6(5), e17711-e17711 (2011-06-04)
Melanin-concentrating hormone receptor 1 (MCHR1) plays a significant role in regulation of energy balance, food intake, physical activity and body weight in humans and rodents. Several association studies for human obesity showed contrary results concerning the SNPs rs133072 (G/A) and
Ditte Demontis et al.
Psychiatric genetics, 22(2), 62-69 (2011-11-15)
The MCHR1 gene encoding the melanin-concentrating hormone receptor 1 is located on chromosome 22q13.2 and has previously been associated with schizophrenia in a study of cases and controls from the Faroe Islands and Scotland. Herein we report an association between
J Chambers et al.
Nature, 400(6741), 261-265 (1999-07-27)
The underlying causes of obesity are poorly understood but probably involve complex interactions between many neurotransmitter and neuropeptide systems involved in the regulation of food intake and energy balance. Three pieces of evidence indicate that the neuropeptide melanin-concentrating hormone (MCH)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service