CN
Search Within
Product Category
Brand
Sustainability
Biological Source
Clonality
Color
Feature
Formula Weight
Gene Alias
Isotype
Physical Form
Purity
Recombinant Host
Antibody Form
Research Area
Conjugate
Quality Segment
Application
Markush Class
Markush Group
Package Size
Post Translational Modification
Non-reactive Species
Species Reactivity
Technique
Available for Sale
10070-92-5
Applied Filters:
Keyword:'10070-92-5'
Showing 1-17 of 17 results for "10070-92-5" within Products
All Photos(1)
Dexamethasone
Synonym(s): Dexamethasone
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| 265005 | Most active and highly stable glucocorticoid. | |||
All Photos(1)
Anti-CD6 Antibody, clone UMCD6
| Compare | Product No. | Clonality | Application | Species Reactivity | Citations | SDS | ||||
|---|---|---|---|---|---|---|---|---|---|---|
| MABF2105 | UMCD6, monoclonal | DB, FACS, IP, inhibition assay | human | |||||||
All Photos(1)
Hygromycin B, Streptomyces sp.
Synonym(s): Hygromycin B, Streptomyces sp.
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| 400051 | Unique aminoglycoside antibiotic that inhibits the growth of prokaryotic (bacteria) and eukaryotic microorganisms (yeasts) and mammalian cells. | |||
All Photos(2)
Protamine sulfate
Synonym(s): Salmine sulfate from salmon sperm, Protamine sulfate
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| P3369 | meets USP testing specifications | |||
All Photos(2)
Anti-ATF2 (Ab-112 or 94) antibody produced in rabbit
Synonym(s): Anti-CRE-BP1 antibody produced in rabbit, Anti-CREB2 antibody produced in rabbit, Anti-HB16 antibody produced in rabbit, Anti-MGC111558 antibody produced in rabbit, Anti-activating transcription factor 2 antibody produced in rabbit
| Compare | Product No. | Clonality | Application | Species Reactivity | Citations | SDS | ||||
|---|---|---|---|---|---|---|---|---|---|---|
| SAB4300317 | polyclonal | IHC (p), WB | mouse, rat, human | |||||||
All Photos(2)
Anti-Nestin Antibody, clone 10C2
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| MAB5326 | clone 10C2, Chemicon®, from mouse | |||
All Photos(3)
Expand™ Long Range dNTPack
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| ELONGN-RO | suitable for PCR, hotstart: no, Long Range PCR | |||
All Photos(1)
Anti-p38 MAP Kinase (341-360) Rabbit pAb
| Compare | Product No. | Clonality | Application | Species Reactivity | Citations | SDS | ||||
|---|---|---|---|---|---|---|---|---|---|---|
| 506123 | polyclonal | mouse, rat, human | 6 | |||||||
All Photos(1)
SNX-482 Recombinant
Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| SML1150 | ≥98% (HPLC) | |||
All Photos(2)
Anti-phospho-HDAC9/HDAC4/HDAC5 (pSer246/pSer259/pSer220) antibody produced in rabbit
Synonym(s): Anti-DKFZp779K1053 antibody produced in rabbit, Anti-FLJ90614 antibody produced in rabbit, Anti-HA6116 antibody produced in rabbit, Anti-histone deacetylase 9 / 4 / 5 antibody produced in rabbit
| Compare | Product No. | Clonality | Application | Species Reactivity | Citations | SDS | ||||
|---|---|---|---|---|---|---|---|---|---|---|
| SAB4300269 | polyclonal | IHC (p), WB | mouse, human | 2 | ||||||
All Photos(1)
MMK-1 trifluoroacetate
Synonym(s): GTPL6240, L-Methionine, L-leucyl-L--glutamyl-L-seryl-L-isoleucyl-L-phenylalanyl-L-arginyl-L-seryl-L-leucyl-L-leucyl-L-phenylalanyl-L-arginyl-L-valyl-, LESIFRSLLFRVM trifluoroacetate, Leu-Glu-Ser-Ile-Phe-Arg-Ser-Leu-Leu-Phe-Arg-Val-Met trifluoroacetate, MMK-1 TFA
Empirical Formula (Hill Notation): C75H123N19O18S · xC2HF3O2
- CAS No.:
- 271246-66-3
- Molecular Weight:
- 1610.96 (free base basis)
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| SML3075 | ≥95% (HPLC) | |||
All Photos(2)
5-Bromoindole
Empirical Formula (Hill Notation): C8H6BrN
- CAS No.:
- 10075-50-0
- Molecular Weight:
- 196.04
- EC No.:
- 233-208-7
- Beilstein No.:
- 112877
All Photos(1)
InnoZyme Cathepsin B Activity Assay Kit, Fluorogenic
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| CBA001 | ||||
All Photos(12)
Anti-IFNγ Antibody, clone 5K15 ZooMAb® Rabbit Monoclonal
Synonym(s): IFN-gamma, Immune interferon, Interferon gamma
| Compare | Product No. | Description | SDS | Pricing | |
|---|---|---|---|---|---|
| ZRB1620 | recombinant, expressed in HEK 293 cells |   | |||
All Photos(1)
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| 1951-M | ||||
All Photos(1)
Hygromycin B, Streptomyces sp., Cell Culture-Tested
Synonym(s): Hygromycin B, Streptomyces sp., Cell Culture-Tested
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| 400050 | Unique aminoglycoside antibiotic that inhibits the growth of prokaryotic (bacteria) and eukaryotic microorganisms (yeasts) and mammalian cells. | |||
All Photos(2)
Protoporphyrin IX zinc(II)
Synonym(s): 3,7,12,17-Tetramethyl-8,13-divinyl-2,18-porphinedipropionic acid, 8,13-Divinyl-3,7,12,17-tetramethyl-21H,23H-porphine-2,18-dipropionic acid zinc derivative, Protoporphyrin IX zinc(II) complex
Empirical Formula (Hill Notation): C34H32N4O4Zn
- CAS No.:
- 15442-64-5
- Molecular Weight:
- 626.03
- EC No.:
- 239-455-7
| Compare | Product No. | Description | SDS | Pricing |
|---|---|---|---|---|
| 282820 | guanylate cyclase inhibitor | |||
Page 1 of 1