119-60-8

Applied Filters:

Keyword:'119-60-8'

Showing 61-90 of 94 results for "119-60-8" within Products

All Photos(1)

[Ala^1,3,11,15]-Endothelin 1

Empirical Formula (Hill Notation): C₁₀₉H₁₆₃N₂₅O₃₂S

CAS No.:: 121204-87-3
Molecular Weight:: 2367.67

Compare	Product No.	Description	SDS	Pricing
	E6877

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

All Photos(1)

Lactoferrin (from bovine milk)

CAS No.:: 146897-68-9

Compare	Product No.	Description	SDS	Pricing
	L-047	certified reference material, pkg of 50 mg, Cerilliant^®

All Photos(1)

Prion Protein Fragment 106-126 Human

Synonym(s): PrP [106-126]

Empirical Formula (Hill Notation): C₈₀H₁₃₈N₂₆O₂₄S₂

CAS No.:: 148439-49-0
Molecular Weight:: 1912.24

Compare	Product No.	Description	SDS	Pricing
	P3615	≥90% (HPLC), solid

All Photos(1)

UFP-101 trifluoroacetate salt

Empirical Formula (Hill Notation): C₈₂H₁₃₈N₃₂O₂₁ · xC₂HF₃O₂

Molecular Weight:: 1908.17 (free base basis)

Compare	Product No.	Description	SDS	Pricing
	U5635	≥98% (HPLC), powder

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Casein Kinase I substrate

Empirical Formula (Hill Notation): C₈₅H₁₃₉N₂₇O₃₅S

CAS No.:: 154444-97-0
Molecular Weight:: 2131.24

Compare	Product No.	Description	SDS	Pricing
	C2335	≥95% (HPLC)

All Photos(1)

Dynorphin A porcine

Synonym(s): Dynorphin-(1-17)

Empirical Formula (Hill Notation): C₉₉H₁₅₅N₃₁O₂₃

CAS No.:: 80448-90-4
Molecular Weight:: 2147.48

Compare	Product No.	Description	SDS	Pricing
	D8147	≥95% (HPLC)

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

Hyperbranched bis-MPA polyester-32-hydroxyl, generation 3

Synonym(s): ALH-32-OH, Hyperbranched Polymer, Hyperpolymer, PFH-32-OH

Empirical Formula (Hill Notation): C₁₅₅H₂₅₆O₉₃

CAS No.:: 326794-48-3
Molecular Weight:: 3607.64

Compare	Product No.	Description	SDS	Pricing
	686581	≥97%

All Photos(1)

Sarafotoxin S6c

Synonym(s): SRTX-c

Empirical Formula (Hill Notation): C₁₀₃H₁₄₇N₂₇O₃₇S₅

CAS No.:: 121695-87-2
Molecular Weight:: 2515.75

Compare	Product No.	Description	SDS	Pricing
	S6545	≥97% (HPLC)

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

All Photos(1)

Corticotropin Releasing Factor Fragment 6-33 human, rat

Empirical Formula (Hill Notation): C₁₄₁H₂₃₁N₄₁O₄₃S

CAS No.:: 120066-38-8
Molecular Weight:: 3220.66

Compare	Product No.	Description	SDS	Pricing
	C0961	≥97% (HPLC)

All Photos(1)

Amyloid β-Protein Fragment 17-40

Compare	Product No.	Description	SDS	Pricing
	A4848	≥87% (HPLC), lyophilized powder

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6383	≥80% (HPLC), powder

All Photos(1)

Magainin II

Empirical Formula (Hill Notation): C₁₁₄H₁₈₀N₃₀O₂₉S

CAS No.:: 108433-95-0
Molecular Weight:: 2466.90

Compare	Product No.	Description	SDS	Pricing
	M7402	≥97% (HPLC)

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Epinecidine-1 trifluoroacetate salt

Synonym(s): Epinecidin-1 trifluoroacetate salt

Empirical Formula (Hill Notation): C₁₁₄H₁₇₆N₃₀O₂₁S·C₂HF₃O₂

Molecular Weight:: 2448.89

Compare	Product No.	Description	SDS	Pricing
	SML0013	≥98% (HPLC)

All Photos(1)

[Leu¹³]-Motilin porcine

Empirical Formula (Hill Notation): C₁₂₁H₁₉₀N₃₄O₃₅

CAS No.:: 116283-54-6
Molecular Weight:: 2681.01

Compare	Product No.	Description	SDS	Pricing
	M7530	≥97% (HPLC)

All Photos(1)

Nisin Ready Made Solution

Empirical Formula (Hill Notation): C₁₄₃H₂₃₀N₄₂O₃₇S₇

CAS No.:: 1414-45-5
Molecular Weight:: 3354.07

Compare	Product No.	Description	SDS	Pricing
	SBR00021	(20,000-40,000 IU/mL in 0.02N HCl)

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C₁₄₇H₂₅₃N₄₅O₄₃

CAS No.:: 125667-96-1
Molecular Weight:: 3338.86

Compare	Product No.	Description	SDS	Pricing
	C7927	≥95% (HPLC), powder

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(2)

Fibronectin Type III Connecting Segment Fragment 1-25

Empirical Formula (Hill Notation): C₁₂₃H₁₉₅N₃₁O₃₉

CAS No.:: 107978-77-8
Molecular Weight:: 2732.05

Compare	Product No.	Description	SDS	Pricing
	F5007	≥90% (HPLC)

All Photos(4)

Empirical Formula (Hill Notation): C₁₃₁H₂₂₉N₃₉O₃₁

CAS No.:: 20449-79-0
Molecular Weight:: 2846.46

Compare	Product No.	Description	SDS	Pricing
	M7391	≥65% (HPLC)
	M2272	≥85% (HPLC)

Page 3 of 4

119-60-8

[Ala1,3,11,15]-Endothelin 1

Cecropin A

Lactoferrin (from bovine milk)

Prion Protein Fragment 106-126 Human

UFP-101 trifluoroacetate salt

Charybdotoxin

Neuropeptide Y, Human

Teriparatide

Casein Kinase I substrate

Dynorphin A porcine

Glucagon, Human

Hyperbranched bis-MPA polyester-32-hydroxyl, generation 3

Sarafotoxin S6c

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Corticotropin Releasing Factor Fragment 6-33 human, rat

Amyloid β-Protein Fragment 17-40

Calcitonin Gene-Related Peptide-I, Human

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Insulin Chain B Oxidized from bovine pancreas

Magainin II

Margatoxin

Epinecidine-1 trifluoroacetate salt

[Leu13]-Motilin porcine

Nisin Ready Made Solution

SNX-482

bis-MPA-Acetylene dendrimer

Cecropin P1 Porcine

SNX-482 Recombinant

Fibronectin Type III Connecting Segment Fragment 1-25

Melittin from honey bee venom

[Ala^1,3,11,15]-Endothelin 1

[Leu¹³]-Motilin porcine