144-29-6

Applied Filters:

Keyword:'144-29-6'

Showing 31-60 of 65 results for "144-29-6" within Products

All Photos(1)

Protein kinase A inhibitor fragment 5-24 amide trifluoroacetate salt

Compare	Product No.	Description	SDS	Pricing
	P7739	≥95% (HPLC), lyophilized powder

All Photos(1)

C-Peptide solution

Empirical Formula (Hill Notation): C₁₂₉H₂₁₁N₃₅O₄₈

CAS No.:: 33017-11-7
Molecular Weight:: 3020.26

Compare	Product No.	Description	SDS	Pricing
	C-243	100 μg/mL (Protease-free 1x PBS), certified reference material, ampule of 0.5 mL, Cerilliant^®

All Photos(1)

Lactoferrin (from bovine milk)

CAS No.:: 146897-68-9

Compare	Product No.	Description	SDS	Pricing
	L-047	certified reference material, pkg of 50 mg, Cerilliant^®

All Photos(1)

Calcitonin, Salmon

Synonym(s): Calcitonin, Salmon

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description	SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Casein Kinase I substrate

Empirical Formula (Hill Notation): C₈₅H₁₃₉N₂₇O₃₅S

CAS No.:: 154444-97-0
Molecular Weight:: 2131.24

Compare	Product No.	Description	SDS	Pricing
	C2335	≥95% (HPLC)

All Photos(1)

Dynorphin A porcine

Synonym(s): Dynorphin-(1-17)

Empirical Formula (Hill Notation): C₉₉H₁₅₅N₃₁O₂₃

CAS No.:: 80448-90-4
Molecular Weight:: 2147.48

Compare	Product No.	Description	SDS	Pricing
	D8147	≥95% (HPLC)

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

PAMAM dendrimer, ethylenediamine core, generation 1.5 solution

Linear Formula: [NH₂(CH₂)₂NH₂]:(G=1.5);dendri PAMAM(NHCH₂CH₂COONa)₁₆

CAS No.:: 202009-64-1
Molecular Weight:: 2934.56

Compare	Product No.	Description	SDS	Pricing
	412392	20 wt. % in methanol

All Photos(1)

Sarafotoxin S6c

Synonym(s): SRTX-c

Empirical Formula (Hill Notation): C₁₀₃H₁₄₇N₂₇O₃₇S₅

CAS No.:: 121695-87-2
Molecular Weight:: 2515.75

Compare	Product No.	Description	SDS	Pricing
	S6545	≥97% (HPLC)

All Photos(1)

GO-201 trifluoroacetate salt

Synonym(s): D-Arg-D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg-Cys-Gln-Cys-Arg-Arg-Lys-Asn-Tyr-Gly-Gln-Leu-Asp-Ile-Phe-Pro trifluoroacetate

Empirical Formula (Hill Notation): C₁₃₃H₂₃₃N₆₁O₃₁S₂ · xC₂HF₃O₂

Molecular Weight:: 3246.79 (free base basis)

Compare	Product No.	Description	SDS	Pricing
	G7923	≥95% (HPLC)

All Photos(1)

Corticotropin Releasing Factor Fragment 6-33 human, rat

Empirical Formula (Hill Notation): C₁₄₁H₂₃₁N₄₁O₄₃S

CAS No.:: 120066-38-8
Molecular Weight:: 3220.66

Compare	Product No.	Description	SDS	Pricing
	C0961	≥97% (HPLC)

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(1)

Amyloid β-Protein Fragment 17-40

Compare	Product No.	Description	SDS	Pricing
	A4848	≥87% (HPLC), lyophilized powder

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.:: 133514-43-9
Molecular Weight:: 3369.76

Compare	Product No.	Description	SDS	Pricing
	E7269	≥95% (HPLC)

All Photos(1)

Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6383	≥80% (HPLC), powder

All Photos(1)

Magainin II

Empirical Formula (Hill Notation): C₁₁₄H₁₈₀N₃₀O₂₉S

CAS No.:: 108433-95-0
Molecular Weight:: 2466.90

Compare	Product No.	Description	SDS	Pricing
	M7402	≥97% (HPLC)

All Photos(1)

Calmodulin-dependent Protein Kinase II fragment 290-309

Synonym(s): CaM kinase II (290-309)

Empirical Formula (Hill Notation): C₁₀₃H₁₈₅N₃₁O₂₄S

CAS No.:: 115044-69-4
Molecular Weight:: 2273.83

Compare	Product No.	Description	SDS	Pricing
	C4926	≥97% (HPLC)

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

[Ala^1,3,11,15]-Endothelin 1

Empirical Formula (Hill Notation): C₁₀₉H₁₆₃N₂₅O₃₂S

CAS No.:: 121204-87-3
Molecular Weight:: 2367.67

Compare	Product No.	Description	SDS	Pricing
	E6877

All Photos(1)

[Leu¹³]-Motilin porcine

Empirical Formula (Hill Notation): C₁₂₁H₁₉₀N₃₄O₃₅

CAS No.:: 116283-54-6
Molecular Weight:: 2681.01

Compare	Product No.	Description	SDS	Pricing
	M7530	≥97% (HPLC)

All Photos(1)

Nisin Ready Made Solution

Empirical Formula (Hill Notation): C₁₄₃H₂₃₀N₄₂O₃₇S₇

CAS No.:: 1414-45-5
Molecular Weight:: 3354.07

Compare	Product No.	Description	SDS	Pricing
	SBR00021	(20,000-40,000 IU/mL in 0.02N HCl)

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C₁₄₇H₂₅₃N₄₅O₄₃

CAS No.:: 125667-96-1
Molecular Weight:: 3338.86

Compare	Product No.	Description	SDS	Pricing
	C7927	≥95% (HPLC), powder

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

Page 2 of 3

144-29-6

Protein kinase A inhibitor fragment 5-24 amide trifluoroacetate salt

C-Peptide solution

Lactoferrin (from bovine milk)

Calcitonin, Salmon

Teriparatide

Casein Kinase I substrate

Dynorphin A porcine

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Glucagon, Human

PAMAM dendrimer, ethylenediamine core, generation 1.5 solution

Sarafotoxin S6c

GO-201 trifluoroacetate salt

Corticotropin Releasing Factor Fragment 6-33 human, rat

Calcitonin Gene-Related Peptide-I, Human

Amyloid β-Protein Fragment 17-40

Margatoxin

Cecropin B

Exendin Fragment 9-39

Insulin Chain B Oxidized from bovine pancreas

Magainin II

Calmodulin-dependent Protein Kinase II fragment 290-309

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

SNX-482

[Ala1,3,11,15]-Endothelin 1

[Leu13]-Motilin porcine

Nisin Ready Made Solution

Charybdotoxin

SNX-482 Recombinant

Cecropin P1 Porcine

Neuropeptide Y, Human

[Ala^1,3,11,15]-Endothelin 1

[Leu¹³]-Motilin porcine