201-289-8

Applied Filters:

Keyword:'201-289-8'

Showing 1-10 of 10 results for "201-289-8" within Products

All Photos(1)

2-(4-tert-Butylbenzyl)propionaldehyde

Synonym(s): 4-tert-Butyl-α-methyl-benzenepropanal, 4-tert-Butyl-α-methyl-hydrocinnamaldehyde, Butylphenyl methylpropional, Lilial

Empirical Formula (Hill Notation): C₁₄H₂₀O

CAS No.:: 80-54-6
Molecular Weight:: 204.31
EC No.:: 201-289-8
Beilstein No.:: 880140

Compare	Product No.	Description	SDS	Pricing
	43884	analytical standard

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

Hyperbranched bis-MPA polyester-64-hydroxyl, generation 4

Synonym(s): ALH-64-OH, Hyperbranched Polymer, Hyperpolymer, PFH-64-OH

Empirical Formula (Hill Notation): C₃₁₅H₅₁₂O₁₈₉

CAS No.:: 326794-48-3
Molecular Weight:: 7323.32

Compare	Product No.	Description	SDS	Pricing
	686573	≥97%

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description		SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

Page 1 of 1