221-222-6

Applied Filters:

Keyword:'221-222-6'

Showing 1-30 of 44 results for "221-222-6" within Products

All Photos(1)

2-Nitrotoluene

Synonym(s): 2-Nitrotoluene

Linear Formula: 2-(NO₂)C₆H₄CH₃

CAS No.:: 88-72-2
Molecular Weight:: 137.14

Compare	Product No.	Description	SDS	Pricing
	8.06806	for synthesis

All Photos(1)

3,4-Dibromothiophene

Empirical Formula (Hill Notation): C₄H₂Br₂S

CAS No.:: 3141-26-2
Molecular Weight:: 241.93
EC No.:: 221-546-8
Beilstein No.:: 107642

Compare	Product No.	Description	SDS	Pricing
	247154	99%

All Photos(2)

Synonym(s): Benzo[b]thiophene, Benzothiophene, Thionaphthene

Empirical Formula (Hill Notation): C₈H₆S

CAS No.:: 95-15-8
Molecular Weight:: 134.20
EC No.:: 202-395-7
Beilstein No.:: 80580

Compare	Product No.	Description	SDS	Pricing
	357790	98%
	T27405	95%

All Photos(1)

2′,4′,6′-Trihydroxyacetophenone monohydrate

Synonym(s): 2′,4′,6′-Trihydroxyacetophenone monohydrate

Empirical Formula (Hill Notation): C₈H₈O₄ · xH₂O

CAS No.:: 480-66-0
Molecular Weight:: 168.15 (anhydrous basis)

Compare	Product No.	Description	SDS	Pricing
	8.41389	for synthesis

All Photos(2)

Synonym(s): 2-Hydroxy-5-methylanisole, 2-Methoxy-p-cresol, 4-Hydroxy-3-methoxytoluene, 4-Methylguaiacol, Creosol

Linear Formula: CH₃OC₆H₃(CH₃)OH

CAS No.:: 93-51-6
Molecular Weight:: 138.16
EC No.:: 202-252-9
Beilstein No.:: 1862340

Compare	Product No.	Description	SDS	Pricing
	41340	analytical standard
	302880	≥98%
	W267104	≥98%, FG
	W267112	natural, 97%, FG

All Photos(3)

2-Amino-3-methylpyridine

Synonym(s): 2-Amino-3-picoline

Empirical Formula (Hill Notation): C₆H₈N₂

CAS No.:: 1603-40-3
Molecular Weight:: 108.14
EC No.:: 216-501-4
Beilstein No.:: 107892

Compare	Product No.	Description	SDS	Pricing
	A75633	95%

All Photos(1)

(1R)-(−)-Myrtenol

Synonym(s): (1R)-2-Pinen-10-ol, (1R)-6,6-Dimethylbicyclo[3.1.1]hept-2-ene-2-methanol

Empirical Formula (Hill Notation): C₁₀H₁₆O

CAS No.:: 19894-97-4
Molecular Weight:: 152.23
EC No.:: 243-409-1
Beilstein No.:: 2206583

Compare	Product No.	Description	SDS	Pricing
	188417	95%

All Photos(1)

Ethyl (2-chlorobenzoyl)acetate

Synonym(s): Ethyl (o-chlorobenzoyl)acetate, Ethyl 3-(2-chlorophenyl)-3-oxopropanoate, NSC 158136

Linear Formula: ClC₆H₄COCH₂CO₂C₂H₅

CAS No.:: 19112-35-7
Molecular Weight:: 226.66

Compare	Product No.	Description	SDS	Pricing
	559091	≥95%

All Photos(2)

2′,3′-O-Isopropylideneadenosine

Empirical Formula (Hill Notation): C₁₃H₁₇N₅O₄

CAS No.:: 362-75-4
Molecular Weight:: 307.31
EC No.:: 206-650-3
Beilstein No.:: 43435

Compare	Product No.	Description	SDS	Pricing
	I22404	98%

All Photos(1)

Linear Formula: CH₃CO(CH₂)₃CO₂C₂H₅

CAS No.:: 13984-57-1
Molecular Weight:: 158.19

Compare	Product No.	Description	SDS	Pricing
	192090	98%
	69333	analytical standard

All Photos(1)

Synonym(s): 1-Amino-2,3-dimethylbenzene, 2,3-Xylidine, 3-Amino-o-xylene, CN-Cbl

Linear Formula: (CH₃)₂C₆H₃NH₂

CAS No.:: 87-59-2
Molecular Weight:: 121.18
EC No.:: 201-755-0
Beilstein No.:: 742174

Compare	Product No.	Description	SDS	Pricing
	1211254	United States Pharmacopeia (USP) Reference Standard
	D145807	99%

All Photos(3)

7-Amino-4-(trifluoromethyl)coumarin

Synonym(s): Coumarin 151

Empirical Formula (Hill Notation): C₁₀H₆F₃NO₂

CAS No.:: 53518-15-3
Molecular Weight:: 229.16
EC No.:: 258-599-1
Beilstein No.:: 4456797

Compare	Product No.	Description	SDS	Pricing
	248924	≥99%

All Photos(2)

2-Nitrophenylhydrazine

Linear Formula: O₂NC₆H₄NHNH₂

CAS No.:: 3034-19-3
Molecular Weight:: 153.14
EC No.:: 221-222-6
Beilstein No.:: 512797

Compare	Product No.	Description	SDS	Pricing
	N21588	97%

All Photos(1)

Mefenamic acid impurity A

Synonym(s): 2,3-Dimethylaniline, 1-Amino-2,3-dimethylbenzene, 2,3-Xylidine, 3-Amino-o-xylene, CN-Cbl

Linear Formula: (CH₃)₂C₆H₃NH₂

CAS No.:: 87-59-2
Molecular Weight:: 121.18
Beilstein No.:: 742174

Compare	Product No.	Description	SDS	Pricing
	Y0001081	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Diethyl propylmalonate

Linear Formula: CH₃CH₂CH₂CH(COOC₂H₅)₂

CAS No.:: 2163-48-6
Molecular Weight:: 202.25
EC No.:: 218-492-2
Beilstein No.:: 510157

Compare	Product No.	Description	SDS	Pricing
	228818	99%

All Photos(1)

Myrtenol

Empirical Formula (Hill Notation): C₁₀H₁₆O

CAS No.:: 19894-97-4
Molecular Weight:: 152.23
EC No.:: 243-409-1

Compare	Product No.	Description	SDS	Pricing
	W343900	≥95%, FG

All Photos(3)

SU 5416

Synonym(s): 1,3-Dihydro-3-[(3,5-dimethyl-1H-pyrrol-2-yl)methylene]-2H-indol-2-one

Empirical Formula (Hill Notation): C₁₅H₁₄N₂O

CAS No.:: 204005-46-9
Molecular Weight:: 238.28

Compare	Product No.	Description	SDS	Pricing
	S8442	≥98% (HPLC)

All Photos(2)

2′,4′,6′-Trihydroxyacetophenone monohydrate

Synonym(s): 2-Acetylphloroglucinol, THAP

Linear Formula: (HO)₃C₆H₂COCH₃·H₂O

CAS No.:: 249278-28-2
Molecular Weight:: 186.16
Beilstein No.:: 9288656

Compare	Product No.	Description	SDS	Pricing
	91928	matrix substance for MALDI-MS, ≥99.5%

All Photos(1)

Corticotropin Releasing Factor Fragment 6-33 human, rat

Empirical Formula (Hill Notation): C₁₄₁H₂₃₁N₄₁O₄₃S

CAS No.:: 120066-38-8
Molecular Weight:: 3220.66

Compare	Product No.	Description	SDS	Pricing
	C0961	≥97% (HPLC)

All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C₁₄₇H₂₅₃N₄₅O₄₃

CAS No.:: 125667-96-1
Molecular Weight:: 3338.86

Compare	Product No.	Description	SDS	Pricing
	C7927	≥95% (HPLC), powder

All Photos(1)

Amyloid Protein Non-Aβ Component

Synonym(s): NAC

Empirical Formula (Hill Notation): C₁₄₁H₂₃₅N₃₉O₄₉

CAS No.:: 154040-19-4
Molecular Weight:: 3260.61

Compare	Product No.	Description	SDS	Pricing
	A2835	≥80% (HPLC)

All Photos(1)

Neuromedin U-25 porcine

Synonym(s): NMU-25

Empirical Formula (Hill Notation): C₁₄₄H₂₁₇N₄₃O₃₇

CAS No.:: 98395-76-7
Molecular Weight:: 3142.53

Compare	Product No.	Description	SDS	Pricing
	N8138	≥97% (HPLC), solid

All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2

Empirical Formula (Hill Notation): C₁₄₇H₂₁₇N₄₃O₃₇S₆

CAS No.:: 99287-07-7
Molecular Weight:: 3370.95

Compare	Product No.	Description	SDS	Pricing
	D6790	≥95% (HPLC)

All Photos(1)

Calcitonin, Salmon

Synonym(s): Calcitonin, Salmon

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description	SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

GO-201 trifluoroacetate salt

Synonym(s): D-Arg-D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg-Cys-Gln-Cys-Arg-Arg-Lys-Asn-Tyr-Gly-Gln-Leu-Asp-Ile-Phe-Pro trifluoroacetate

Empirical Formula (Hill Notation): C₁₃₃H₂₃₃N₆₁O₃₁S₂ · xC₂HF₃O₂

Molecular Weight:: 3246.79 (free base basis)

Compare	Product No.	Description	SDS	Pricing
	G7923	≥95% (HPLC)

All Photos(1)

PACAP 27 Amide, Ovine

Synonym(s): PACAP 27 Amide, Ovine

Empirical Formula (Hill Notation): C₁₄₂H₂₂₄N₄₀O₃₉S

CAS No.:: 127317-03-7
Molecular Weight:: 3147.61

Compare	Product No.	Description	SDS	Pricing
	05-23-2151	Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).

Page 1 of 2

221-222-6

2-Nitrotoluene

3,4-Dibromothiophene

Thianaphthene

2′,4′,6′-Trihydroxyacetophenone monohydrate

2-Methoxy-4-methylphenol

2-Amino-3-methylpyridine

(1R)-(−)-Myrtenol

Ethyl (2-chlorobenzoyl)acetate

2′,3′-O-Isopropylideneadenosine

Ethyl 4-acetylbutyrate

2,3-Dimethylaniline

7-Amino-4-(trifluoromethyl)coumarin

2-Nitrophenylhydrazine

Mefenamic acid impurity A

Diethyl propylmalonate

Myrtenol

SU 5416

2′,4′,6′-Trihydroxyacetophenone monohydrate

Corticotropin Releasing Factor Fragment 6-33 human, rat

Cecropin P1 Porcine

Amyloid Protein Non-Aβ Component

Neuromedin U-25 porcine

Defensin HNP-2 human

Calcitonin, Salmon

SNX-482 Recombinant

SNX-482

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Parathyroid Hormone 1-34, Human

GO-201 trifluoroacetate salt

PACAP 27 Amide, Ovine