229-87-8

Applied Filters:

Keyword:'229-87-8'

Showing 1-23 of 23 results for "229-87-8" within Products

All Photos(1)

Phenanthridine

Synonym(s): Benzo[c]quinoline

Empirical Formula (Hill Notation): C₁₃H₉N

CAS No.:: 229-87-8
Molecular Weight:: 179.22
EC No.:: 205-934-4
Beilstein No.:: 120204

Compare	Product No.	Description	SDS	Pricing
	157384	98%

All Photos(1)

Phenoxy-2-propanone

Synonym(s): Phenoxyacetone

Linear Formula: C₆H₅OCH₂COCH₃

CAS No.:: 621-87-4
Molecular Weight:: 150.17
EC No.:: 210-712-5

Compare	Product No.	Description	SDS	Pricing
	152021	97%

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.:: 133514-43-9
Molecular Weight:: 3369.76

Compare	Product No.	Description	SDS	Pricing
	E7269	≥95% (HPLC)

All Photos(1)

Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6383	≥80% (HPLC), powder

All Photos(1)

Calcitonin, Salmon

Synonym(s): Calcitonin, Salmon

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description	SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.

All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C₁₄₇H₂₅₃N₄₅O₄₃

CAS No.:: 125667-96-1
Molecular Weight:: 3338.86

Compare	Product No.	Description	SDS	Pricing
	C7927	≥95% (HPLC), powder

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

Amyloid Protein Non-Aβ Component

Synonym(s): NAC

Empirical Formula (Hill Notation): C₁₄₁H₂₃₅N₃₉O₄₉

CAS No.:: 154040-19-4
Molecular Weight:: 3260.61

Compare	Product No.	Description	SDS	Pricing
	A2835	≥80% (HPLC)

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

Nisin Ready Made Solution

Empirical Formula (Hill Notation): C₁₄₃H₂₃₀N₄₂O₃₇S₇

CAS No.:: 1414-45-5
Molecular Weight:: 3354.07

Compare	Product No.	Description	SDS	Pricing
	SBR00021	(20,000-40,000 IU/mL in 0.02N HCl)

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2

Empirical Formula (Hill Notation): C₁₄₇H₂₁₇N₄₃O₃₇S₆

CAS No.:: 99287-07-7
Molecular Weight:: 3370.95

Compare	Product No.	Description	SDS	Pricing
	D6790	≥95% (HPLC)

Page 1 of 1