258-256-6

Applied Filters:

Keyword:'258-256-6'

Showing 1-20 of 20 results for "258-256-6" within Products

All Photos(5)

Starch, soluble

Linear Formula: (C₆H₁₀O₅)_n

EC No.:: 232-679-6

Compare	Product No.	Description	SDS	Pricing
	S9765	ACS reagent

All Photos(9)

Synonym(s): 1,2-Diaminobenzene, 1,2-Phenylenediamine, OPD

Empirical Formula (Hill Notation): C₆H₈N₂

CAS No.:: 95-54-5
Molecular Weight:: 108.14
EC No.:: 202-430-6
Beilstein No.:: 606074

Compare	Product No.	Description	SDS	Pricing
	74477	analytical standard
	P23938	flaked, 99.5%
	P9029	Peroxidase substrate, ≥98.0%, powder
	P5412	tablet, 20 mg substrate per tablet
	694975	sublimed, ≥99%

All Photos(1)

4-Chloro-3-sulfamoylbenzoic acid

Linear Formula: ClC₆H₃(SO₂NH₂)CO₂H

CAS No.:: 1205-30-7
Molecular Weight:: 235.64
EC No.:: 214-882-1

Compare	Product No.	Description	SDS	Pricing
	293598	98%

All Photos(3)

2-Adamantanone

Empirical Formula (Hill Notation): C₁₀H₁₄O

CAS No.:: 700-58-3
Molecular Weight:: 150.22
EC No.:: 211-847-2
Beilstein No.:: 1210235

Compare	Product No.	Description	SDS	Pricing
	146048	ReagentPlus^®, 99%

All Photos(1)

Chrysene

Synonym(s): Chrysene

Empirical Formula (Hill Notation): C₁₈H₁₂

CAS No.:: 218-01-9
Molecular Weight:: 228.29

Compare	Product No.	Description	SDS	Pricing
	8.41690	for synthesis

All Photos(4)

Cinnamoyl chloride

Synonym(s): trans-3-Phenylacryloyl chloride

Linear Formula: C₆H₅CH=CHCOCl

CAS No.:: 102-92-1
Molecular Weight:: 166.60
EC No.:: 203-065-5
Beilstein No.:: 606265

Compare	Product No.	Description	SDS	Pricing
	C81101	≥95.0%

All Photos(1)

N_α-Acetyl-L-lysine

Linear Formula: H₂N(CH₂)₄CH(NHCOCH₃)CO₂H

CAS No.:: 1946-82-3
Molecular Weight:: 188.22
EC No.:: 217-747-5

Compare	Product No.	Description	SDS	Pricing
	A2010

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(2)

Empirical Formula (Hill Notation): C₂₂H₁₉Br₂NO₃

CAS No.:: 52918-63-5
Molecular Weight:: 505.20
EC No.:: 258-256-6
Beilstein No.:: 6746312

Compare	Product No.	Description	SDS	Pricing
	45423	PESTANAL^®, analytical standard
	05995	certified reference material, TraceCERT^®, Manufactured by: Sigma-Aldrich Production GmbH, Switzerland

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

Page 1 of 1

258-256-6

Starch, soluble

o-Phenylenediamine

4-Chloro-3-sulfamoylbenzoic acid

2-Adamantanone

Chrysene

Cinnamoyl chloride

Nα-Acetyl-L-lysine

SNX-482

Deltamethrin

SNX-482 Recombinant

Cecropin A

Neuropeptide Y, Human

Charybdotoxin

Teriparatide

Margatoxin

Cecropin B

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Calcitonin Gene-Related Peptide-I, Human

bis-MPA-Acetylene dendrimer

Parathyroid Hormone 1-34, Human

N_α-Acetyl-L-lysine