Search Within
Product Category
Brand
Biological Source
Feature
Formula Weight
Gene Alias
Manufacturer
Physical Form
Purity
Recombinant Host
Quality Segment
Application
Reference Material Type
Special Grade
Sterility
Technique
Available for Sale
302-97-6
Applied Filters:
Keyword:'302-97-6'
Showing 1-27 of 27 results for "302-97-6" within Products
All Photos(1)
PACAP (1-38), human, ovine, rat
- CAS No.:
- 137061-48-4
- Molecular Weight:
- 4534.32
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H9BC14710 | ||||||||
All Photos(1)
Aprotinin
- CAS No.:
- 9087-70-1
- Molecular Weight:
- 6511.53
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H93D8DCBC | ||||||||
All Photos(2)
- CAS No.:
- 2012558-47-1
- Molecular Weight:
- 5398.94
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BDPH9BCC1D1A | ||||||||
| ST9H9BC19058 | ||||||||
All Photos(1)
Epidermal Growth Factor
- CAS No.:
- 62253-63-8
- Molecular Weight:
- 6222.06
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H9BC137D0 | ||||||||
All Photos(1)
Insulin(cattle)
- CAS No.:
- 11070-73-8
- Molecular Weight:
- 5733.57
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H9BC137BB | ||||||||
All Photos(1)
Insulin (human)
- CAS No.:
- 11061-68-0
- Molecular Weight:
- 5807.65
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H9BC14721 | ||||||||
All Photos(1)
Retatrutide
- CAS No.:
- 2381089-83-2
- Molecular Weight:
- 4731.41
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H9BC138E0 | ||||||||
All Photos(1)
L-Leucyl-L-leucylglycyl-L-α-aspartyl-L-phenylalanyl-L-phenylalanyl-L-arginyl-L-lysyl-L-seryl-L-lysyl-L-α-glutamyl-L-lysyl-L-isoleucylglycyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-lysyl-L-arginyl-L-isoleucyl-L-valyl-L-glutaminyl-L-arginyl-L-isoleucyl-L-lysyl-L-α-aspartyl-L-phenylalanyl-L-leucyl-L-arginyl-L-asparaginyl-L-leucyl-L-valyl-L-prolyl-L-arginyl-L-threonyl-L-α-glutamyl-L-serinamide
- CAS No.:
- 597562-32-8
- Molecular Weight:
- 4492.34
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BDPH9C0232BF | ||||||||
All Photos(2)
- CAS No.:
- 2023788-19-2
- Molecular Weight:
- 4813.52
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BDPH9BCC9F8F | ||||||||
| ST9H9BC137BD | ||||||||
All Photos(1)
Mazdutide
- CAS No.:
- 2259884-03-0
- Molecular Weight:
- 4563.13
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BDPH9BCE0D72 | ||||||||
All Photos(1)
N-Acetyl-L-tyrosyl-L-threonyl-L-seryl-L-leucyl-L-isoleucyl-L-histidyl-L-seryl-L-leucyl-L-isoleucyl-L-α-glutamyl-L-α-glutamyl-L-seryl-L-glutaminyl-L-asparaginyl-L-glutaminyl-L-glutaminyl-L-α-glutamyl-L-lysyl-L-asparaginyl-L-α-glutamyl-L-glutaminyl-L-α-glutamyl-L-leucyl-L-leucyl-L-α-glutamyl-L-leucyl-L-α-aspartyl-L-lysyl-L-tryptophyl-L-alanyl-L-seryl-L-leucyl-L-tryptophyl-L-asparaginyl-L-tryptophyl-L-phenylalaninamide
- CAS No.:
- 159519-65-0
- Molecular Weight:
- 4491.94
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BDPH9C02066E | ||||||||
All Photos(1)
ACTH (1-39) human
- CAS No.:
- 12279-41-3
- Molecular Weight:
- 4541.13
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| ST9H9BC179BC | ||||||||
All Photos(1)
SILu™Prot APOA2 Apolipoprotein A-II human
| Compare | Product No. | Form | Assay | Biological Source | Recombinant | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| MSST0029 | lyophilized powder | ≥98% (SDS-PAGE) | human | expressed in HEK 293 cells | |||||||
All Photos(1)
Gastric Inhibitory Polypeptide human
Synonym(s): GIP, Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| G2269 | ≥95% (HPLC), suitable for ligand binding assays | |||||||
All Photos(1)
ProteoMass™ Insulin MALDI-MS Standard
Synonym(s): Insulin from bovine pancreas
Empirical Formula (Hill Notation): C254H377N65O75S6
- CAS No.:
- 11070-73-8
- Molecular Weight:
- 5733.49
- EC No.:
- 234-291-2
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| I6279 | vial of 10 nmol, monoisotopic mol wt 5,729.6087 Da | |||||||
All Photos(2)
Insulin from porcine pancreas
Synonym(s): Insulin from hog pancreas
Empirical Formula (Hill Notation): C256H381N65O76S6
- CAS No.:
- 12584-58-6
- Molecular Weight:
- 5777.54
- EC No.:
- 235-703-3
| Compare | Product No. | Biological Source | Form | Assay | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|---|---|
| I5523 | Porcine pancreas | powder | ≥98% | |||||||
All Photos(8)
Synonym(s): Insulin human
All Photos(1)
Insulin (porcine)
Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| I0320000 | European Pharmacopoeia (EP) Reference Standard | |||||||
All Photos(9)
Empirical Formula (Hill Notation): C254H377N65O75S6
- CAS No.:
- 11070-73-8
- Molecular Weight:
- 5733.49
- EC No.:
- 234-291-2
All Photos(1)
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 91077C | for research or for further manufacturing use, dry powder | |||||||
All Photos(1)
Insulin solution human
- CAS No.:
- 11061-68-0
| Compare | Product No. | Biological Source | Form | Assay | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|---|---|
| I9278 | — | solution | — | |||||||
All Photos(1)
Human Insulin
Synonym(s): Insulin human
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| PHR8925 | certified reference material, pharmaceutical secondary standard | |||||||
All Photos(1)
Insulin porcine for system suitability
Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| Y0001717 | European Pharmacopoeia (EP) Reference Standard | |||||||
All Photos(1)
Insulin (Pork)
Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 1342300 | United States Pharmacopeia (USP) Reference Standard | |||||||
All Photos(1)
bis-MPA-Acetylene dendrimer
Empirical Formula (Hill Notation): C279H326O138
- Molecular Weight:
- 5887.49
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 806153 | trimethylol propane core, generation 3 | |||||||
All Photos(1)
Neuropeptide Y, Human
Synonym(s): Neuropeptide Y, Human
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 05-23-2005 | A potent vasoconstrictor. | |||||||
All Photos(1)
SNX-482 Recombinant
Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Page 1 of 1