3268-79-9

Applied Filters:

Keyword:'3268-79-9'

Showing 1-25 of 25 results for "3268-79-9" within Products

All Photos(7)

Synonym(s): Insulin sodium salt human, Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57
EC No.:: 234-279-7

Compare	Product No.	Description	SDS	Pricing
	I0908	meets USP testing specifications
	91077C	dry powder, for research or for further manufacturing use
	I2643	recombinant, expressed in yeast (proprietary host)
	11376497001	recombinant (yeast)
	I3536	recombinant, expressed in yeast, γ-irradiated, suitable for cell culture

All Photos(1)

Substance P

Synonym(s): Substance P

Empirical Formula (Hill Notation): C₆₃H₉₈N₁₈O₁₃S

CAS No.:: 33507-63-0
Molecular Weight:: 1347.63

Compare	Product No.	Description	SDS	Pricing
	05-23-0600	Neuropeptide found in high concentrations in the gut.

All Photos(2)

Insulin from porcine pancreas

Synonym(s): Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54
EC No.:: 235-703-3

Compare	Product No.	Description	SDS	Pricing
	I5523	powder, ≥27 USP units/mg

All Photos(1)

Anti-Islet-1 homeobox Antibody, clone 40.2D6

Compare	Product No.	Clonality	Application	Species Reactivity	Citations		SDS
	MABN2729	40.2D6, monoclonal	ChIP, EM, FACS, ICC, IF, IHC, IP, WB	frog, rhesus macaque, zebrafish, human, mouse, rat, guinea pig, canine

All Photos(1)

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description	SDS	Pricing
	I0320000	European Pharmacopoeia (EP) Reference Standard
	1342300	United States Pharmacopeia (USP) Reference Standard
	Y0001717	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Fura-2 LR/AM

Synonym(s): Fura-2 LR/AM

Empirical Formula (Hill Notation): C₅₅H₆₃N₅O₂₉

CAS No.:: 172890-84-5
Molecular Weight:: 1258.10

Compare	Product No.	Description	SDS	Pricing
	344911	Acetoxymethyl (AM) derivative of FURA-PE3 with spectral properties similar to the parent compound.

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

Natriuretic Peptide, C-Type, Human and Porcine

Synonym(s): Natriuretic Peptide, C-Type, Human and Porcine

Empirical Formula (Hill Notation): C₉₃H₁₅₇N₂₇O₂₈S₃

CAS No.:: 127869-51-6
Molecular Weight:: 2197.60

Compare	Product No.	Description	SDS	Pricing
	05-23-0310	Member of the natriuretic peptide family that shares structural homology with ANP and plays a role in the regulation of body fluid homeostasis, vascular tone, and vascular growth.

All Photos(1)

MAS 7

Synonym(s): MAS 7

Empirical Formula (Hill Notation): C₆₇H₁₂₄N₁₈O₁₅

CAS No.:: 145854-59-7
Molecular Weight:: 1421.81

Compare	Product No.	Description	SDS	Pricing
	444896	A cell-permeable, amphiphilic, mastoparan analog with five-fold greater potency than Mastoparan.

All Photos(1)

Triprolidine hydrochloride

Synonym(s): (E)-2-[3-(1-Pyrrolidinyl)-1-p-tolylpropenyl]pyridine hydrochloride, trans-2-[3-(1-Pyrrolidinyl)-1-p-tolylpropenyl]pyridine hydrochloride

Empirical Formula (Hill Notation): C₁₉H₂₂N₂ · HCl

CAS No.:: 6138-79-0
Molecular Weight:: 314.85

Compare	Product No.	Description	SDS	Pricing
	BP347	British Pharmacopoeia (BP) Reference Standard

All Photos(1)

Empirical Formula (Hill Notation): C₆₀H₁₀₂O₂₉

CAS No.:: 88901-36-4
Molecular Weight:: 1287.43

Compare	Product No.	Description	SDS	Pricing
	PHL80498	phyproof^® Reference Substance
	1445448	United States Pharmacopeia (USP) Reference Standard

All Photos(1)

ProteoMass^™ Insulin MALDI-MS Standard

Synonym(s): Insulin from bovine pancreas

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Compare	Product No.	Description	SDS	Pricing
	I6279	vial of 10 nmol, monoisotopic mol wt 5,729.6087 Da

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

Mastoparan-7

Synonym(s): Mas 7

Empirical Formula (Hill Notation): C₆₇H₁₂₄N₁₈O₁₅

CAS No.:: 145854-59-7
Molecular Weight:: 1421.81

Compare	Product No.	Description	SDS	Pricing
	M212	≥97% (HPLC), lyophilized powder

All Photos(1)

Empirical Formula (Hill Notation): C₅₉H₉₆O₂₆

CAS No.:: 14216-03-6
Molecular Weight:: 1221.38
Beilstein No.:: 4229541

Compare	Product No.	Description	SDS	Pricing
	00930585	primary reference standard
	97151	analytical standard
	PHL89221	phyproof^® Reference Substance

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

Insulin solution human

CAS No.:: 11061-68-0

Compare	Product No.	Description	SDS	Pricing
	I9278	sterile-filtered, BioXtra, suitable for cell culture

Page 1 of 1

3268-79-9

Insulin human

Substance P

Insulin from porcine pancreas

Anti-Islet-1 homeobox Antibody, clone 40.2D6

Insulin (porcine)

Fura-2 LR/AM

Parathyroid Hormone 1-34, Human

Natriuretic Peptide, C-Type, Human and Porcine

MAS 7

Triprolidine hydrochloride

Mogroside V

ProteoMass™ Insulin MALDI-MS Standard

bis-MPA-Acetylene dendrimer

SNX-482

Mastoparan-7

Hederacoside C

SNX-482 Recombinant

Cecropin A

Neuropeptide Y, Human

Charybdotoxin

Teriparatide

Margatoxin

Cecropin B

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Insulin solution human

ProteoMass^™ Insulin MALDI-MS Standard