Merck
CN
Search Within
Document Type

95-76-1

Applied Filters:
Keyword:'95-76-1'
Showing 1-30 of 510 results for "95-76-1" within Technical Documents
The Effective Use of Protein Kinase Inhibitors
102 101 76 50 58 77 87 76 38 83 78 85 85 97 95 39 83 10 78 91 93 95 94 90 85 99 39 39 93 82 80 109 79 76 74 89 73 82 102
The Effective Use of Protein Kinase Inhibitors
102 101 76 50 58 77 87 76 38 83 78 85 85 97 95 39 83 10 78 91 93 95 94 90 85 99 39 39 93 82 80 109 79 76 74 89 73 82 102
Poster: Purification with Millipore MultiScreen 384SEQ Plates on Beckman-Coulter’s Biomek FX for High Quality Direct Sequencing in High-Throughput Genomics
resequencing necessary il12a_7-A zq r1 38.97 383.58 76% il12a_7-A zq r1 40.55 400.58 76% il12a_7-A zq r1 40.03 403.13 75% il12a_7-A zq r2 42.17 436.31 76% il12a_7-A zq r2 34.63 293.07 68% no resequencing
Data Sheet - F8551
mature 76 amino acid variant of the chemokine domain of mature rat fractalkine (amino acid residues 25 to 100, QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKR AIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTR NG).1 Rat fractalkine
Data Sheet - SAB4200862
concentration by titration test. References 1. Lamas A., et al., Microbiol Res., 206: 60-73 (2018). 2. Dos Santos AMP., et al., Curr Microbiol., 76: 762-773 (2019). 3. Yang L. and Li
Spare parts for Mobius®Bioreactors (50 L, 200 L, 1000 L & 2000 L)
Nipple Only 52 86 1 5 76 50 97 96 87 94 95 76 2 84 78 79 51 3 80 82 4
Data Sheet - SAB4200868
Y., et al. J Immunol., 184, 2671–76 (2010). 7. Castro MS., et al., J Appl Microbiol.,121, 1117–29 (2016). 8. Zhou Y., et al., Medicine (Baltimore), 95, e5019 (2016). 9. Knoop KA.
Chromolith columns Applications - Concor
at pH2,3 Gradient 0 min 5%A 95%B 2 min 20%A 80%B 5 min 20%A 80%B Flow rate 4 ml/min Detection 220 nm Temp. 30°C Pressure 76 bar Inj.Volume 20 µl Sample 1) „Benzylalkohol“ 9,2µg/ml
Data Sheet - SRP5129
and mDia1, in transformation, metastasis and invasion. Cancer Metastasis Rev., 28(1-2), 65-76 (2009). RC,MAM 11/11-1 2011 Sigma-Aldrich Co. LLC. All rights reserved. SIGMA-ALDRICH is a trademark
Data Sheet - SRP5221
Avoid repeated handling and multiple freeze/thaw cycles. Figure 1. SDS-PAGE Gel of Typical Lot 70–95% (densitometry) References 1. Jensen, L.R. et al., Mutations in the JARID1C gene, which is
Data Sheet - SRP5148
.1 mM EDTA, 0.25 mM DTT, 0.1 mM PMSF, and 25% glycerol. Molecular mass: ∼76 kDa Purity: 70–95% (SDS-PAGE, see Figure 1) Precautions and Disclaimer This product is for R&D use only, not for drug
Aldrich Polymer Products Application - Transitions
ether -43 86 4-Fluorostyrene 95 Formaldehyde -82 181 Hexadecyl acrylate 35 Hexadecyl methacrylate 15 Hexyl acrylate 57 Hexyl methacrylate -5 2-Hydropropyl methacrylate 76 Hydroquinone-alt-epichlorohydrin
(C9422) - Enzyme Assay
REFERENCE: Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical Corporation, Freehold, NJ NOTES: 1. This assay is based on the cited reference. 2. Where Sigma Product
(C0898) - Enzyme Assay
REFERENCE: Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical Corporation, Freehold, NJ NOTES: 1. This assay is based on the cited reference. 2. Where Sigma Product
(C8546) - Enzyme Assay
REFERENCE: Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical Corporation, Freehold, NJ NOTES: 1. This assay is based on the cited reference. 2. Where Sigma Product
Data Sheet - F7751
Endocrinology 134(3), 1401 (1994). CONTROLLED SUBSTANCE - DEA LICENSE REQUIRED (III) Rev. 1/95
User Guide - SAE0176
221–233 (2007). 5. Hannocks, M.J. et al., Matrix. Biol. 75–76: 102-113 (2019). 6. Medeiros. N.I. et al. Parasite Immunol. 39(8): 1-8 (2017). 7. Radosinska, J. et al., Panminerva Med. 59(3):
Monoclonal Anti-Bcl-2 antibody produced in mouse (B9804)
c mice immunized with a synthetic peptide corresponding to amino acids 61-76 of the mouse Bcl-2 sequence conjugated to KLH.1 The isotype is determined by a double diffusion immunoassay using Mouse
Data Sheet - F2792
stain 1 x 10 , cells a fluorescence intensity is is constitutively expressed on most peripheral blood T observed similar to that obtained with saturating monoclonal lymphocytes (approximately 95% of CD4
RABBIT ANTI-ARGININE VASOPRESSIN RECEPTOR (AVPR-V2) AFFINITY PURIFIED POLYCLONAL ANTIBODY
1.0 μg/mL using 1 μg/mL of control peptide to coat plate. Optimal working dilutions must be determined by the end user. SPECIES REACTIVITY: Rat. The immunogen peptide has 95% homology with
Product Information - 128708
This product is soluble in 95% ethanol (50 mg/ml), yielding a clear faint yellow solution. Heat may be required to get it to dissolve at that concentration. References 1. The Merck Index, 11th ed.
Data Sheet - I2659
we recommend determining optimal working dilutions by titration. References 1. Lee, R.T., et al., Cir. Res., 76, 209 (1995). 2. Chan, B.M., et al., Cell, 68, 1051 (1992). 3. Bergelson, J.M., et
Data Sheet - A5156
NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm
Data Sheet - A4262
NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm
Data Sheet - A1410
NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm
Actinomycin D (A9415)
NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm
Product Information Sheet - SAE0171
. Curr. Heart Fail. Rep., 11(1): 58–63 (2014). 3. Verdecchia, P. et al., The pivotal link between ACE2 deficiency and SARS-CoV-2 infection. Eur. J. Intern. Med., 76: 14-20 (2020). 4. Hoffmann
Data Sheet - 31404
and inhibit initial adsorption to susceptible cells. 25 References: 1. Rankin, J.C. and Jeanes, A., J. Am. Chem. Soc., 76, 4435 (1954). 2. Dimler, R.J. et al., J. Am. Chem. Soc., 77, 6568 (1955).
c-Jun N-Terminal Kinase from rat muscle (C3108)
stimulated by UV light and Ha-Ras that binds and phosphorylates the c-Jun activation domain. Cell, 76, 1025-1037 (1994). 7. Kyriakis, J.M., et al., The stress-activated protein kinase subfamily of
Product Information Sheet - T1647
Number: 76-05-1 pKa: 0.3; 1 0.23 (water at 25 °C)2; 0.50 (water at 25 °C)3 Melting Point: -15.4 °C 1 Boiling Point: 72.4 °C;1 70.5-72 °C 2 Density: 1.489 g/ml (20 C)4; 1.535 g/ml (20
Page 1 of 17