Anti-RGS3 antibody produced in rabbit

Synthetic peptide directed towards the C terminal region of human RGS3

Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Regulator of G-protein signaling-3 (RGS3) accelerates the GTPase activity of G(i) and G(q) subunits. It interacts with the Smad transcription factors that are activated by TGF-β and prevents the heteromerization of Smad3 and Smad4. This results in inhibition of transcriptional activity of Smads and inhibition of TGF-β-induced differentiation of myofibroblasts. In sensory neurons, RGS3 mediates the termination of G protein signaling by calcium influx through voltage-gated channels. The role of RGS3 in collaboration with Ephrin-B is important in the maintenance of the neural progenitor cells.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.