Quality Level
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50- 1:200
immunogen sequence
SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SLC13A3(64849)
General description
SLC13A3 (solute carrier family 13, member 3) belongs to SLC13 family of five members. This family is divided into Na+-sulphate (NaS) cotransporters and Na+-carboxylate (NaC) cotransporters, and SLC13A3 belongs to the latter group. It is a transporter with 12 transmembrane regions, and is composed of 602 amino acids. This gene maps to human chromosome 20q12-13.1, spans more than 80kb, and has 13 exons, and 12 introns. It has three predicted N-linked glycosylation sites. It is localized to the proximal tubule cells in the basolateral membrane. It is also expressed in brain, liver, pancreas and placenta.
Immunogen
Solute carrier family 13 member 3 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
SLC13A3 (solute carrier family 13, member 3) acts in collaboration with organic anion transporter 1 (OAT1) and OAT3) to facilitate the release of multiple endogenous and exogenous organic ions. It provides intracellular α-ketoglutarate, in a Na+-dependent manner, to OAT1 and 3, to allow for organic anion/dicarboxylate exchange. It is a glutathione (GSH) transporter of low-affinity. It is responsible for the uptake of GSH by the proximal tubule cells of basolateral membrane, in a sodium-dependent manner. Mutations in this gene might have a link to idiopathic nephrolithiasis. This transporter is also responsible for the uptake of N-carbamoylglutamate (NCG) from blood. NCG is a drug which is used to treat inborn n-acetylglutamate synthase deficiency. SLC13A3 might be involved in myelination, as it is responsible for the Na+-dependent transport of N-acetylaspartate in brain.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST73142
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
Daniel Markovich et al.
Pflugers Archiv : European journal of physiology, 447(5), 594-602 (2003-08-14)
The SLC13 gene family consist of five sequence-related members that have been identified in a variety of animals, plants, yeast and bacteria. Proteins encoded by these genes are divided into two functionally unrelated groups: the Na(+)-sulphate (NaS) cotransporters and the
Lena Schorbach et al.
Nephron. Physiology, 124(1-2), 1-5 (2013-11-20)
During a single pass through the kidneys, more than 80% of glutathione (GSH) is excreted, indicating not only glomerular filtration, but also tubular secretion. The first step in tubular secretion is the uptake of a substance across the basolateral membrane
W Huang et al.
The Journal of pharmacology and experimental therapeutics, 295(1), 392-403 (2000-09-19)
N-Acetylaspartate is a highly specific marker for neurons and is present at high concentrations in the central nervous system. It is not present at detectable levels anywhere else in the body other than brain. Glial cells express a high-affinity transporter
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA014736-100UL | 04061835680580 |
| HPA014736-25UL | 04061842803996 |