biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:200- 1:500
immunogen sequence
QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HSCB(150274)
General description
The gene HSCB (iron-sulfur cluster co-chaperone protein HscB, mitochondrial) is mapped to human chromosome 22q12.1. It is expressed in various tissues and is mainly present in the mitochondria. However, small amount of HSCB is also detected outside mitochondria. It contains a conserved amino-terminal J-domain and a less conserved carboxyl-terminal region. It is popularly known as HSC20 (Heat shock cognate 20).
Immunogen
Co-chaperone protein HscB, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-HSCB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
In the biogenesis of iron-sulfur proteins, the final step of iron-sulfur protein assembly involves transfer of an iron-sulfur cluster from a cluster-donor to a cluster-acceptor protein. This process is mediated by a molecular chaperone from the Hsc70 (Heat shock cognate) family and a co-chaperone of the J-domain family. HSCB (Iron-sulfur cluster co-chaperone protein HscB, mitochondrial) is homolog of DnaJ type co-chaperones. It is required for mitochondrial iron-sulfur cluster (ISC) assembly. Depletion of HSCB reduces mitochondrial and cytosolic ISC-containing enzymes. On the other hand, overexpression of HSCB protects cells from oxidative stress. HSCB interacts with iron-sulfur cluster scaffold protein and mitochondrial HSP70 (Heat shock protein).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST74558
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
法规信息
新产品
此项目有
Nunziata Maio et al.
Proceedings of the National Academy of Sciences of the United States of America, 120(33), e2303860120-e2303860120 (2023-08-08)
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of COVID-19, uses an RNA-dependent RNA polymerase along with several accessory factors to replicate its genome and transcribe its genes. Nonstructural protein (nsp) 13 is a helicase required for viral
Kai Cai et al.
The Journal of biological chemistry, 288(40), 28755-28770 (2013-08-14)
Human ISCU is the scaffold protein for mitochondrial iron-sulfur (Fe-S) cluster biogenesis and transfer. NMR spectra have revealed that ISCU populates two conformational states; that is, a more structured state (S) and a partially disordered state (D). We identified two
Jucimara Colombo et al.
Oncology reports, 21(3), 649-663 (2009-02-13)
Laryngeal squamous cell carcinoma is very common in head and neck cancer, with high mortality rates and poor prognosis. In this study, we compared expression profiles of clinical samples from 13 larynx tumors and 10 non-neoplastic larynx tissues using a
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA018447-100UL | 04061837138492 |
| HPA018447-25UL | 04061842837731 |