Monoclonal Anti-RNF19 antibody produced in mouse

The protein encoded this gene contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson′s disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB. Alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)

RNF19 (NP_056250, 739 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTE

Solution

GenBank is a registered trademark of United States Department of Health and Human Services