Monoclonal Anti-IL23R antibody produced in mouse

Interleukin 23 receptor (IL23R) gene codes for a subunit of the IL-23 receptor. The gene is mapped to human chromosome 1p31.3.

IL23R (NP_653302, 553 a.a. ~ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLE

Interleukin 23 receptor (IL23R) IL-12Rβ1 and forms IL-23 complex, which is essential for IL-23 signaling. It constitutively combines with Janus kinase 2 (JAK2). IL23R attaches to transcription activator signal transducer and activator of transcription 3 (STAT3) in a ligand-dependent manner and has a proinflammatory function. IL23R gene defends against Crohn′s disease.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.