Skip to Content
Merck
CN

219483

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control

A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58).

Synonym(s):

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK- WGI DKASFTTFTVTKYWF RY, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

Empirical Formula (Hill Notation):
C228H335N61O49S
Molecular Weight:
4746.54
UNSPSC Code:
12352200
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

assay

≥95% (HPLC)

form

lyophilized solid

manufacturer/tradename

Calbiochem®

storage condition

OK to freeze, desiccated (hygroscopic), protect from light

color

white

solubility

DMSO: 2 mg/mL

shipped in

wet ice

storage temp.

−20°C

Quality Level

General description

A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482 ).

Biochem/physiol Actions

Cell permeable: no
Primary Target
Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
Product does not compete with ATP.
Reversible: no

Packaging

Packaged under inert gas

Physical form

Supplied as a trifluoroacetate salt.

Preparation Note

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Other Notes

Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Bucci, M., et al. 2000. Nat. Med.6, 1362.
H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Arg-Tyr-OH

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Standard Handling (A)

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ivan Jozic et al.
Communications biology, 4(1), 757-757 (2021-06-20)
Although impaired keratinocyte migration is a recognized hallmark of chronic wounds, the molecular mechanisms underpinning impaired cell movement are poorly understood. Here, we demonstrate that both diabetic foot ulcers (DFUs) and venous leg ulcers (VLUs) exhibit global deregulation of cytoskeletal

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service