APREST71273
PrEST Antigen LRP4
Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution
Synonym(s):
MEGF7
recombinant
expressed in E. coli
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 32 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
IQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVCACPDEPDSQPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAP
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... LRP4(4038)
General description
LRP4 (low-density lipoprotein receptor-related protein 4a) is also called the multiple epidermal growth factor-like domains 7 (MEGF7). It is mapped to human chromosome 11p11.2. Low-density lipoprotein receptor-related protein 4a (LRP4) has epidermal growth factor repeat domain and four β-propeller domains.
Application
Suitable as a blocking agent using corresponding antibodies.
Biochem/physiol Actions
It modulates wnt signal transduction pathway. It is crucial for development of limbs and is essential for neuromuscular junction formation. Mutations in the LRP4 gene is associated with Cenani-Lenz syndrome (CLS), a disorder with abnormal distal limb development. Defective splicing of LRP4 leads to mulefoot disease. Mutations in the β-propeller domains of LRP4 is implicated in congenital myasthenic syndromes, a disorder of nerve impulse transmission.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA011934.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Novel splice mutation in LRP4 causes severe type of Cenani-Lenz syndactyly syndrome with oro-facial and skeletal symptoms
Afzal M, et al.
European Journal of Medical Genetics, 60(8), 421-425 (2017)
Multiple modes of Lrp4 function in modulation of Wnt beta-catenin signaling during tooth development
Ahn Y, et al.
Development, dev-150680 (2017)
LDL-receptor-related protein 4 is crucial for formation of the neuromuscular junction
Weatherbee SD, et al.
Development, 133(24), 4993-5000 (2006)
New Horizons for Lipoprotein Receptors Communication by beta-propellers
Andersen OM, et al.
Journal of Lipid Research, jlr-M039545 (2013)
LRP4 third beta-propeller domain mutations cause novel congenital myasthenia by compromising agrin-mediated MuSK signaling in a position-specific manner
Ohkawara B, et al.
Human Molecular Genetics, 23(7), 1856-1868 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service