Skip to Content
Merck
CN

APREST72768

PrEST Antigen CHRM1

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352202
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 32 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CHRM1(1128)

General description

Recombinant protein fragment of Human CHRM1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Cholinergic receptor, muscarinic 1 (CHRM1) is also known as muscarinic acetylcholine receptor M1 (mAChRs). It encoded by gene CHRM1 located on human chromosome 11q12.3. Cholinergic receptor, muscarinic 1 (CHRM1) belongs to G protein-coupled receptors and comprises of 5 subtypes: M1 to M5.

Application

Suitable as a blocking agent using corresponding antibodies.

Biochem/physiol Actions

CHRM1 is activated by acetylcholine and it regulates multitude of physiological processes of the central and peripheral nervous system. It is also associated with learning, cognition and memory. CHRM1 is allosterically regulated and is a prime target for drug design in disorders of central nervous system. CHRM1 receptor modulation improves cognitive function. Elevated levels of CHRM1- acetylcholine complex is observed in patients with Alzheimer′s disease. Single polynucleotide polymorphisms in CHRM1 is observed in patients with schizophrenia. Mutations in the CHRM1 gene locus is associated with facial impairment and developmental delay.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Other Notes

Corresponding Antibody HPA014101.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The effect of a muscarinic receptor 1 gene variant on grey matter volume in schizophrenia
Cropley VL, et al.
Psychiatry research. Neuroimaging, 234(2), 182-187 (2015)
A selective allosteric potentiator of the M1 muscarinic acetylcholine receptor increases activity of medial prefrontal cortical neurons and restores impairments in reversal learning
Shirey JK, et al.
The Journal of Neuroscience, 29(45), 14271-14286 (2009)
Crystal structures of the M1 and M4 muscarinic acetylcholine receptors
Thal DM, et al.
Nature, 531(7594), 335-335 (2016)
Toshiyuki Yamamoto et al.
Molecular cytogenetics, 6(1), 15-15 (2013-04-05)
Triplication is a rare chromosomal anomaly. We identified a de novo triplication of 11q12.3 in a patient with developmental delay, distinctive facial features, and others. In the present study, we discuss the mechanism of triplications that are not embedded within
Muscarinic acetylcholine receptors: mutant mice provide new insights for drug development
Wess J, et al.
Nature Reviews Drug Discovery, 6(9), 721-721 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service