APREST91711
PrEST Antigen S100A3
Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution
Synonym(s):
S100E
recombinant
expressed in E. coli
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 22 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... S100A3(6274)
General description
Recombinant protein fragment of Human S100A3 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Blocking agent and positive assay control using corresponding antibodies.
Physical form
Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA056140.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service