APREST95089
PrEST Antigen MYOCD
Prestige Antibodies® Powered by Atlas Antibodies, buffered aqueous solution
Synonym(s):
MYCD
recombinant
expressed in E. coli
product line
Prestige Antibodies® Powered by Atlas Antibodies
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 25 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
sequence note
ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... MYOCD(93649)
General description
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Application
Suitable as a blocking agent and positive assay control using corresponding antibodies.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
Store at -20°C. Avoid repeated freeze/thaw cycles.
Other Notes
Corresponding Antibodies HPA071528
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service