Skip to Content
Merck
CN

APREST95495

Sigma-Aldrich

PrEST Antigen ZNF843

Prestige Antibodies® Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):

MGC46336

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

recombinant

expressed in E. coli

product line

Prestige Antibodies® Powered by Atlas Antibodies

Assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 25 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

sequence note

PDSTSGLRPCGSPGSFLQHLPPSTLLPRPPFLYPGPPLSLQPLVPSGLPAVPAVPLGGLEVAQVPPATQPAAQQ

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ZNF843(283933)

General description

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Application

Suitable as a blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

Store at -20°C. Avoid repeated freeze/thaw cycles.

Other Notes

Corresponding Antibodies HPA077945
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service