Skip to Content
Merck
CN

AV100613

Anti-IRF2 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Interferon regulatory factor 2

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

dog, guinea pig, rat, human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable, western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IRF2(3660)

General description

Interferon regulatory factors are transcription factors that regulate the expression of interferon system. IRF-1 is a transcription activator whereas IRF-2 represses the activity of IRF-1.

Immunogen

Synthetic peptide directed towards the N terminal region of human IRF2

Application

Anti-IRF2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

IRFs bind to the cis elements within type 1 IFN and IFN-inducible genes. IRF-1 and -2 have antagonistic effects and any imbalance in the activities results in hematopoietic neoplasms. IRF-2 transcriptionally activates VCAM-1 in the muscle cells and is important for skeletal myogenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: APLFRNRAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKK

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

wgk

WGK 3

Storage Class

12 - Non Combustible Liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

T L Jesse et al.
The Journal of cell biology, 140(5), 1265-1276 (1998-04-18)
Previously, we have suggested that vascular cell adhesion molecule-1 (VCAM-1) and its integrin receptor alpha4beta1 mediate cell-cell interactions important for skeletal myogenesis. Expression of the receptors subsequently subsides in muscle after birth. Here, we examine the mechanism regulating VCAM-1 gene
Evidence for a soluble lymphocyte factor in the transplacental transmission of T-lymphocyte responses to Mycobacterium leprae.
R S Barnetson et al.
Nature, 260(5547), 150-151 (1976-03-11)
Toshitaka Sakai et al.
Pancreas, 43(6), 909-916 (2014-03-19)
Pancreatic cancer is one of the most malignant diseases worldwide. Interferon regulatory factor (IRF) 1 and IRF2 function as a tumor suppressor and oncoprotein, respectively, in several types of cancers. We investigated whether IRF1 and IRF2 are involved in the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service