Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
39 kDa
species reactivity
dog, guinea pig, rat, human, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... IRF2(3660)
General description
Interferon regulatory factors are transcription factors that regulate the expression of interferon system. IRF-1 is a transcription activator whereas IRF-2 represses the activity of IRF-1.
Immunogen
Synthetic peptide directed towards the N terminal region of human IRF2
Application
Anti-IRF2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
IRFs bind to the cis elements within type 1 IFN and IFN-inducible genes. IRF-1 and -2 have antagonistic effects and any imbalance in the activities results in hematopoietic neoplasms. IRF-2 transcriptionally activates VCAM-1 in the muscle cells and is important for skeletal myogenesis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: APLFRNRAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
wgk
WGK 3
Storage Class
12 - Non Combustible Liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
T L Jesse et al.
The Journal of cell biology, 140(5), 1265-1276 (1998-04-18)
Previously, we have suggested that vascular cell adhesion molecule-1 (VCAM-1) and its integrin receptor alpha4beta1 mediate cell-cell interactions important for skeletal myogenesis. Expression of the receptors subsequently subsides in muscle after birth. Here, we examine the mechanism regulating VCAM-1 gene
Evidence for a soluble lymphocyte factor in the transplacental transmission of T-lymphocyte responses to Mycobacterium leprae.
R S Barnetson et al.
Nature, 260(5547), 150-151 (1976-03-11)
Toshitaka Sakai et al.
Pancreas, 43(6), 909-916 (2014-03-19)
Pancreatic cancer is one of the most malignant diseases worldwide. Interferon regulatory factor (IRF) 1 and IRF2 function as a tumor suppressor and oncoprotein, respectively, in several types of cancers. We investigated whether IRF1 and IRF2 are involved in the
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service