AV100748
Anti-MyBL2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-v-Myb myeloblastosis viral oncogene homolog (avian)-like 2
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
79 kDa
species reactivity
guinea pig, rat, rabbit, human, bovine, zebrafish, horse, canine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... MYBL2(4605)
General description
Myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 (MyBL2), a MYB family member, is a transcription factor involved in the regulation of cyclin A/cyclin-dependent kinase 2-dependent cell cycle progression. MyBL2 is implicated in the development and maintenance of the stem cell phenotype with a role in the proliferation and differentiation of several cell types. MYBL2 plays a subtle but key role in linking specific aspects of cell-cycle progression with generation of signals for differentiation. MYBL2 is implicated in human malignancies such as hepatocellular carcinoma (HCC).
Rabbit polyclonal anti-MyBL2 antibody reacts with canine, rat, zebrafish, bovine, chicken, and human Myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 transcription factors.
Immunogen
The immunogen for anti-MYBL2 antibody: synthetic peptide derected towards the N terminal of human MYBL2
Application
Anti-MyBL2 antibody produced in rabbit is suitable for western blotting at a working concentration of 0.5-1.0 μg/ml. A concentration of 4-8 μg/ml may be used for immunohistochemistry of paraffin-embedded tissue sections.
Rabbit polyclonal anti-MyBL2 antibody is used to tag Myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 in cell-cycle progression and differentiation.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Wei Li et al.
Cancer medicine, 9(2), 689-699 (2019-11-24)
Lung adenocarcinoma (LUAD) is the most common form of malignant tumor and closely correlated with high risk of death worldwide. Accumulating researches have manifested that long noncoding RNAs (lncRNAs) are deeply involved in the progression of multiple cancers. LncRNA LOXL1
Guo-Jun Geng et al.
Experimental and therapeutic medicine, 15(2), 1633-1639 (2018-02-13)
Non-small-cell lung cancer (NSCLC) is one of the leading causes of cancer mortality worldwide. A growing body of evidence indicates that microRNA (miR) have important and diverse roles in the proliferation, apoptosis and metastasis of human cancer cells. In the
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service