AV100920
Anti-E2F5 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
38 kDa
species reactivity
human, dog, rabbit, guinea pig, mouse, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... E2F5(1875)
General description
The members of E2F family of transcription factors bind to promoter regions and regulate cell proliferation.
Immunogen
Synthetic peptide directed towards the N terminal region of human E2F5
Application
Anti-E2F5 antibody produced in rabbit is suitable for western blotting at a concentration of 0.4 μg/ml.
Biochem/physiol Actions
Overexpression of E2F5 has been reported in solid tumors of breast, ovarian, colon and hepatocellular carcinoma. It is a transcription repressor with regulatory roles in cell proliferation, growth and cell cycle progression.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
A potential oncogenic role of the commonly observed E2F5 overexpression in hepatocellular carcinoma.
Yuzhu Jiang et al.
World journal of gastroenterology, 17(4), 470-477 (2011-01-29)
To explore the expression pattern of E2F5 in primary hepatocellular carcinomas (HCCs) and elucidate the roles of E2F5 in hepatocarcinogenesis. E2F5 expression was analyzed in 120 primary HCCs and 29 normal liver tissues by immunohistochemistry analysis. E2F5-small interfering RNA was
Alicia Subtil-Rodríguez et al.
Nucleic acids research, 42(4), 2185-2196 (2013-11-23)
The precise regulation of S-phase-specific genes is critical for cell proliferation. How the repressive chromatin configuration mediated by the retinoblastoma protein and repressor E2F factors changes at the G1/S transition to allow transcription activation is unclear. Here we show ChIP-on-chip
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service