Skip to Content
Merck
CN

AV13052

Anti-PACSIN1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-KIAA1379, Anti-Protein kinase C and casein kinase substrate in neurons 1

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

rat, mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PACSIN1(29993)

Immunogen

Synthetic peptide directed towards the C terminal region of human PACSIN1

Application

Anti-PACSIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

PACSIN1 is a neuron-specific member of PACSIN family, specifically expressed in human and mouse plasmacytoid dendritic cells. PACSIN1 interacts with tubulin and regulates membrane deformation, linking membrane trafficking and actin organization. It binds with Tau protein in axon and regulates axonal elongation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Eiji Esashi et al.
European journal of immunology, 42(3), 573-579 (2012-04-11)
Plasmacytoid dendritic cells (pDCs) are the professional interferon (IFN)-producing cells of the immune system. pDCs specifically express Toll-like receptor (TLR)7 and TLR9 molecules and produce massive amounts of type I IFN by sensing microbial nucleic acids via TLR7 and TLR9.
Yingying Liu et al.
The Journal of biological chemistry, 287(47), 39911-39924 (2012-10-05)
Tau is a major member of the neuronal microtubule-associated proteins. It promotes tubulin assembly and stabilizes axonal microtubules. Previous studies have demonstrated that Tau forms cross-bridges between microtubules, with some particles located on cross-bridges, suggesting that some proteins interact with

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service