Skip to Content
Merck
CN

AV31366

Sigma-Aldrich

Anti-ATF1 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Activating transcription factor 1, Anti-EWS-ATF1, Anti-FUS/ATF-1, Anti-TREB36

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

29 kDa

species reactivity

rabbit, horse, dog, rat, guinea pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATF1(466)

General description

ATF1 is a member of the AMP response element-binding protein/activating transcription factor (CREB/ATF) that associates with BRCA1. ATF1 target genes have been implicated in mediating transcriptional response to DNA damage. Moreover, studies have reported that phosphorylation of ATF1 is needed for growth factor-induced expression of c-jun.
Rabbit Anti-ATF1 (AB2) antibody recognizes rat, mouse, zebrafish, bovine, and human ATF1.

Immunogen

Synthetic peptide directed towards the middle region of human ATF1

Application

Rabbit Anti-ATF1 (AB2) antibody can be used for western blotting (0.5μg/ml) applications.

Biochem/physiol Actions

ATF1 binds the cAMP response element (CRE) (consensus: 5′-GTGACGT [AC] [AG]-3′), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Pankaj Gupta et al.
The Journal of biological chemistry, 277(52), 50550-50556 (2002-11-05)
Epidermal growth factor induction of c-jun expression requires ATF1 and MEF2 sites in the c-jun promoter. We find that activation of the c-jun promoter through the ATF1 site requires phosphorylation of ATF1 at serine 63. A serine 63 to alanine
Y Houvras et al.
The Journal of biological chemistry, 275(46), 36230-36237 (2000-08-18)
BRCA1, a breast and ovarian cancer susceptibility gene, encodes a 220-kDa protein whose precise biochemical function remains unclear. BRCA1 contains an N-terminal RING finger that mediates protein-protein interaction. The C-terminal domain of BRCA1 (BRCT) can activate transcription and interacts with

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service