biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
29 kDa
species reactivity
human, zebrafish, rat, bovine, canine, rabbit, mouse, guinea pig, horse, sheep
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... FOSL1(8061)
General description
FOSL1 has been identified as a transcriptional target of c-Fos during the differentiation of osteoclasts. Furthermore, FOSL1 functions as a downstream effector of PI3K/AKT signaling and regulates trophoblast development during the establishment of maternal-fetal interfaces.
Rabbit Anti-FOSL1 antibody recognizes bovine, human, mouse, rat, and canine FOSL1.
Rabbit Anti-FOSL1 antibody recognizes bovine, human, mouse, rat, and canine FOSL1.
Immunogen
The immunogen for anti-FOSL1 antibody: synthetic peptide derected towards the middle region of human FOSL1
Application
Rabbit Anti-FOSL1 antibody can be used for western blot ( 0.5μg/ml) and immunohistochemical (4-8μg/ml) assays.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
K Matsuo et al.
Nature genetics, 24(2), 184-187 (2000-02-02)
Osteoclasts are bone-resorbing cells derived from haematopoietic precursors of the monocyte-macrophage lineage. Mice lacking Fos (encoding c-Fos) develop osteopetrosis due to an early differentiation block in the osteoclast lineage. c-Fos is a component of the dimeric transcription factor activator protein-1
Hana Janouskova et al.
Nature medicine, 23(9), 1046-1054 (2017-08-15)
It is generally assumed that recurrent mutations within a given cancer driver gene elicit similar drug responses. Cancer genome studies have identified recurrent but divergent missense mutations affecting the substrate-recognition domain of the ubiquitin ligase adaptor SPOP in endometrial and
Lindsey N Kent et al.
Molecular and cellular biology, 31(23), 4801-4813 (2011-09-29)
Remodeling of uterine spiral arteries by trophoblast cells is a requisite process for hemochorial placentation and successful pregnancy. The rat exhibits deep intrauterine trophoblast invasion and accompanying trophoblast-directed vascular modification. The involvement of phosphatidylinositol 3 kinase (PI3K), AKT, and Fos-like
Li-Li Zhao et al.
Neural regeneration research, 18(9), 2056-2066 (2023-03-18)
The key regulators and regeneration-associated genes involved in axonal regeneration of neurons after injury have not been clarified. In high-throughput sequencing, various factors influence the final sequencing results, including the number and size of cells, the depth of sequencing, and
Chunyan Zhao et al.
Cancer research, 74(14), 3983-3994 (2014-05-17)
Triple-negative breast cancer (TNBC) is an aggressive clinical subtype accounting for up to 20% of all breast cancers, but its malignant determinants remain largely undefined. Here, we show that in TNBC the overexpression of Fra-1, a component of the transcription
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service