Skip to Content
Merck
CN

AV31377

Sigma-Aldrich

Anti-FOSL1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FOS-like antigen 1, Anti-FRA1, Anti-Fra-1

Sign Into View Organizational & Contract Pricing

Select a Size

About This Item

UNSPSC Code:
12352203

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

29 kDa

species reactivity

human, zebrafish, rat, bovine, canine, rabbit, mouse, guinea pig, horse, sheep

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

NP_005429

UniProt accession no.

P15407

storage temp.

−20°C

Gene Information

human ... FOSL1(8061)

General description

FOSL1 has been identified as a transcriptional target of c-Fos during the differentiation of osteoclasts. Furthermore, FOSL1 functions as a downstream effector of PI3K/AKT signaling and regulates trophoblast development during the establishment of maternal-fetal interfaces.
Rabbit Anti-FOSL1 antibody recognizes bovine, human, mouse, rat, and canine FOSL1.

Immunogen

The immunogen for anti-FOSL1 antibody: synthetic peptide derected towards the middle region of human FOSL1

Application

Rabbit Anti-FOSL1 antibody can be used for western blot ( 0.5μg/ml) and immunohistochemical (4-8μg/ml) assays.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC4815

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lindsey N Kent et al.
Molecular and cellular biology, 31(23), 4801-4813 (2011-09-29)
Remodeling of uterine spiral arteries by trophoblast cells is a requisite process for hemochorial placentation and successful pregnancy. The rat exhibits deep intrauterine trophoblast invasion and accompanying trophoblast-directed vascular modification. The involvement of phosphatidylinositol 3 kinase (PI3K), AKT, and Fos-like
K Matsuo et al.
Nature genetics, 24(2), 184-187 (2000-02-02)
Osteoclasts are bone-resorbing cells derived from haematopoietic precursors of the monocyte-macrophage lineage. Mice lacking Fos (encoding c-Fos) develop osteopetrosis due to an early differentiation block in the osteoclast lineage. c-Fos is a component of the dimeric transcription factor activator protein-1
Li-Li Zhao et al.
Neural regeneration research, 18(9), 2056-2066 (2023-03-18)
The key regulators and regeneration-associated genes involved in axonal regeneration of neurons after injury have not been clarified. In high-throughput sequencing, various factors influence the final sequencing results, including the number and size of cells, the depth of sequencing, and
Hana Janouskova et al.
Nature medicine, 23(9), 1046-1054 (2017-08-15)
It is generally assumed that recurrent mutations within a given cancer driver gene elicit similar drug responses. Cancer genome studies have identified recurrent but divergent missense mutations affecting the substrate-recognition domain of the ubiquitin ligase adaptor SPOP in endometrial and
Chunyan Zhao et al.
Cancer research, 74(14), 3983-3994 (2014-05-17)
Triple-negative breast cancer (TNBC) is an aggressive clinical subtype accounting for up to 20% of all breast cancers, but its malignant determinants remain largely undefined. Here, we show that in TNBC the overexpression of Fra-1, a component of the transcription

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service