AV31426
Anti-TAF10 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-TAF10 antibody produced in rabbit, affinity isolated antibody
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
22 kDa
species reactivity
human, rat, bovine, mouse, guinea pig, rabbit, dog, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... TAF10(6881)
Application
Rabbit Anti-TAF10 antibody can be used for western blot applications at 0.5μg/ml.
Biochem/physiol Actions
TAF10 plays a major role in transcription by binding to the TBP-associated factors (TAFs). It interacts with the AF-2-containing region E of the human estrogen receptor (ER). In conjugation with high-mobility group (HMG) protein HMG-1, TAF10 facilitates estrogen receptor-mediated transcriptional activation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TAF10 is a transcription factor that forms a part of the TFIID and other regulatory complexes (such as SAGA, TFTC, STAGA and PCAF/GCN5). TAF10 is required for mouse embryogenesis and is known to establish skin barrier function in fetal mouse epidermis.
Rabbit Anti-TAF10 antibody recognizes mouse, human, canine, zebrafish, rat, bovine, and pig TAF10.
Rabbit Anti-TAF10 antibody recognizes mouse, human, canine, zebrafish, rat, bovine, and pig TAF10.
Immunogen
Synthetic peptide directed towards the C terminal region of human TAF10
Other Notes
Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Arup Kumar Indra et al.
Developmental biology, 285(1), 28-37 (2005-07-26)
TFIID, composed of the TATA box binding protein (TBP) and 13 TBP-associated factors (TAFs), plays a role in nucleating the assembly of the RNA polymerase II preinitiation complexes on protein coding genes. TAF10 (formerly TAF(II)30) is shared between TFIID and
E Scheer et al.
Genomics, 29(1), 269-272 (1995-09-01)
The basal RNA polymerase II transcription factor, TFIID, is composed of the TATA binding protein (TBP) and 8-13 TBP-associated factors (TAFs) ranging from 250 to 17 kDa. The structure of the human gene encoding the 30-kDa subunit of TFIID, TAF2H
J A Van Der Knaap et al.
The Biochemical journal, 345 Pt 3, 521-527 (2000-01-22)
The TATA-binding protein (TBP) plays a central role in eukaryotic transcription and forms protein complexes with TBP-associated factors (TAFs). The genes encoding TAF(II) proteins frequently map to chromosomal regions altered in human neoplasias. TAF(II)170 of B-TFIID is a member of
C S Verrier et al.
Molecular endocrinology (Baltimore, Md.), 11(8), 1009-1019 (1997-07-01)
The estrogen receptor (ER) belongs to a family of ligand-inducible nuclear receptors that exert their effects by binding to cis-acting DNA elements in the regulatory region of target genes. The detailed mechanisms by which ER interacts with the estrogen response
X Jacq et al.
Cell, 79(1), 107-117 (1994-10-07)
We showed previously that coactivators mediating stimulation by different activators were associated with the TATA-binding protein (TBP) in distinct TFIID complexes. We have characterized a human TBP-associated factor (TAF), hTAFII30, associated with a subset of TFIID complexes. hTAFII30 interacts with
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service