Skip to Content
Merck
CN

AV31513

Anti-RIPK3 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-RIP3, Anti-RIP3beta, Anti-RIP3gamma, Anti-Receptor-interacting serine-threonine kinase 3

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
MDL number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

57 kDa

species reactivity

horse, rat, bovine, canine, pig, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable, western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... RIPK3(11035)

Looking for similar products? Visit Product Comparison Guide

General description

Rabbit polyclonal anti-RIPK3 antibody reacts with mouse, bovine, canine, and human receptor-interacting serine-threonine kinase 3 kinases.
Receptor-interacting serine-threonine kinase 3 (RIPK3, RIP3β, RIP3gamma) is a key signaling molecule in the programmed necrosis (necroptosis) pathway. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and it is involved in the regulation of (tumor necrosis factor (TNF)-related apoptosis inducing ligand) TRAIL-induced apoptosis.

Immunogen

The immunogen for anti-RIPK3 antibody: synthetic peptide derected towards the N terminal of human RIPK3

Application

Anti-RIPK3 antibody has been used for the studying the role of RIPK3 in necroptosis. The antibody can be used for western blot (1.25μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) applications.
Rabbit polyclonal anti-RIPK3 antibody is used to tag receptor-interacting serine-threonine kinase 3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of receptor-interacting serine-threonine kinase 3 apoptosis pathways.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Linde Duprez et al.
The Journal of biological chemistry, 287(18), 14863-14872 (2012-03-01)
Receptor-interacting protein kinase 1 (RIPK1) is an important component of the tumor necrosis factor receptor 1 (TNFR1) signaling pathway. Depending on the cell type and conditions, RIPK1 mediates MAPK and NF-κB activation as well as cell death. Using a mutant

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service