AV32342
Anti-PSMD4 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
41 kDa
species reactivity
horse, bovine, human, mouse, sheep, rabbit, dog, rat, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... PSMD4(5710)
General description
PSDM4 is the non-ATPase subunit of the proteasomal 19S regulatory complex that is involved in proteasome-substrate identification. Porcine fertilization studies have reported that PSMD4 regulates sperm-zona pellucida (ZP) penetration. Furthermore, pharmacogenomic analyses have revealed that high expression of PSDM4 is linked to adverse clinical outcomes in myeloma patients undergoing bortezomib treatment.
Rabbit Anti-PSMD4 (AB1) antibody recognizes canine, human, mouse, rat, pig, bovine, chicken, and rabbit PSMD4.
Rabbit Anti-PSMD4 (AB1) antibody recognizes canine, human, mouse, rat, pig, bovine, chicken, and rabbit PSMD4.
Immunogen
Synthetic peptide directed towards the N terminal region of human PSMD4
Application
Rabbit Anti-PSMD4 (AB2) antibody can be used for western blot applications at a concentration of 0.3μg/ml.
Biochem/physiol Actions
PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid which is part of a multicatalytic proteinase complex of the 26S proteasome.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Young-Joo Yi et al.
Cell and tissue research, 341(2), 325-340 (2010-06-08)
Proteolysis of ubiquitinated sperm and oocyte proteins by the 26S proteasome is necessary for the success of mammalian fertilization, including but not limited to acrosomal exocytosis and sperm-zona pellucida (ZP) penetration. The present study examined the role of PSMD4, an
John D Shaughnessy et al.
Blood, 118(13), 3512-3524 (2011-06-02)
Gene expression profiling (GEP) of purified plasma cells 48 hours after thalidomide and dexamethasone test doses showed these agents' mechanisms of action and provided prognostic information for untreated myeloma patients on Total Therapy 2 (TT2). Bortezomib was added in Total
Kihyun Pyun et al.
Pharmacology, biochemistry, and behavior, 124, 278-283 (2014-07-06)
Primary headache disorders, including migraine, are thought to be mediated by prolonged nociceptive activation of the trigeminal nucleus caudalis (TNC), but the precise mechanisms are poorly understood. Our past studies demonstrated that sigma-1 receptors (Sig-1R) facilitate spinal nociceptive transmission in
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service