Product Name
Anti-SNAI1 antibody produced in rabbit, affinity isolated antibody
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
29 kDa
species reactivity
human, rat, guinea pig, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
application(s)
research pathology
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SNAI1(6615)
Application
Rabbit polyclonal anti-SNAI1 antibody is used to tag Snail homolog 1 (Drosophila)for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Snail homolog 1 in epithelial to mesenchymal transition (EMT) during embryogenesis and tumor progression.
Biochem/physiol Actions
Rabbit polyclonal anti-SNAI1 antibody reacts with human, mouse, and rat Snail homolog 1 proteins.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Snail homolog 1 (Drosophila) (SNAI1), a zinc finger transcription factor, is a transcription repressor that down-regulates the expression of ectodermal genes within the mesoderm. SNAI1 triggers the initiation of epithelial to mesenchymal transition (EMT), a process that provies epithelial cells with mesenchymal features and invasive properties during embryonic development and tumor progression. Consequently, Snai1 plays a major role in tumor growth, cell invasion and metastasis.
Immunogen
Synthetic peptide directed towards the N terminal of human SNAI1.
Other Notes
Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL
Physical form
Lyophilized from PBS buffer with 2% sucrose
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Weidong Zhao et al.
Clinical and investigative medicine. Medecine clinique et experimentale, 36(4), E223-E233 (2013-08-03)
Epithelial-mesenchymal transition (EMT) is crucial for tumor progression and metastasis. Snail family members, including Snail, Slug and Smuc, are the transcription factors that repress E-cadherin expression and induce epithelial-mesenchymal transition in some tumor tissues. In this study, the expression of
Seung-Hyun Jeong et al.
Molecular medicine reports, 14(6), 5148-5154 (2016-10-26)
Hypoxia-induced epithelial-mesenchymal transition (EMT) has been identified as essential for tumor progression and metastasis. The present study examined the effects of an antioxidant, dieckol, on hypoxia‑induced EMT in HT29 human colorectal cancer cells. HT29 cells were treated with a hypoxia‑inducing
Damian Ryszawy et al.
Carcinogenesis, 35(9), 1920-1930 (2014-02-08)
Suppressive function of connexin(Cx)43 in carcinogenesis was recently contested by reports that showed a multifaceted function of Cx43 in cancer progression. These studies did not attempt to model the dynamics of intratumoral heterogeneity involved in the metastatic cascade. An unorthodox
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service