Skip to Content
Merck
CN

AV34144

Anti-RFP2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45 kDa

species reactivity

human, dog, rabbit, guinea pig, horse, mouse, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... RFP2(10206)

General description

RFP2 (or TRIM13) codes for a protein that has zinc-binding domains along with RING, B-box type 1 and 2, and coiled-coil regions. TRIM13 is known to function as an ERAD E3 ubiquitin ligase.
Rabbit Anti-RFP2 antibody recognizes human, mouse, rat, bovine, and canine RFP2.

Immunogen

Synthetic peptide directed towards the middle region of human RFP2

Application

Rabbit Anti-RFP2 antibody can be used for western blot applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

The protein encoded by RFP2 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. RFP2 is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQR

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mikael Lerner et al.
Molecular biology of the cell, 18(5), 1670-1682 (2007-02-23)
RFP2, a gene frequently lost in various malignancies, encodes a protein with RING finger, B-box, and coiled-coil domains that belongs to the RBCC/TRIM family of proteins. Here we demonstrate that Rfp2 is an unstable protein with auto-polyubiquitination activity in vivo

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service