AV34144
Anti-RFP2 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
45 kDa
species reactivity
human, dog, rabbit, guinea pig, horse, mouse, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... RFP2(10206)
General description
RFP2 (or TRIM13) codes for a protein that has zinc-binding domains along with RING, B-box type 1 and 2, and coiled-coil regions. TRIM13 is known to function as an ERAD E3 ubiquitin ligase.
Rabbit Anti-RFP2 antibody recognizes human, mouse, rat, bovine, and canine RFP2.
Rabbit Anti-RFP2 antibody recognizes human, mouse, rat, bovine, and canine RFP2.
Immunogen
Synthetic peptide directed towards the middle region of human RFP2
Application
Rabbit Anti-RFP2 antibody can be used for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
The protein encoded by RFP2 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. RFP2 is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQR
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Mikael Lerner et al.
Molecular biology of the cell, 18(5), 1670-1682 (2007-02-23)
RFP2, a gene frequently lost in various malignancies, encodes a protein with RING finger, B-box, and coiled-coil domains that belongs to the RBCC/TRIM family of proteins. Here we demonstrate that Rfp2 is an unstable protein with auto-polyubiquitination activity in vivo
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service