biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
47 kDa
species reactivity
rat, rabbit, horse, guinea pig, human, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... P2RXL1(9127)
General description
P2RXL1 is a P2X receptor that is expressed in skeletal muscles. It is regulated by p53 and associates with VE-cadherin in umbilical endothelial cells of humans.
Rabbit Anti-P2RXL1 antibody recognizes human, mouse, rat, bovine, canine, and chicken P2RXL1.
Rabbit Anti-P2RXL1 antibody recognizes human, mouse, rat, bovine, canine, and chicken P2RXL1.
Immunogen
Synthetic peptide directed towards the N terminal region of human P2RXL1
Application
Rabbit Anti-P2RXL1 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
P2RXL1 encodes a protein in the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. P2RXL1 is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service