Skip to Content
Merck
CN

AV35634

Anti-PITX2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Paired-like homeodomain transcription factor 2

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

36 kDa

species reactivity

canine, rabbit, bovine, mouse, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable, western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... PITX2(5308)

Looking for similar products? Visit Product Comparison Guide

General description

Paired-like homeodomain transcription factor 2 (PITX2) also known as pituitary homeobox 2 is a homeodomain transcription factor that regulates expression of genes critical for proper eye, tooth and abdominal organ development as well as expression of pituitary-specific genes including prolactin. Mutations in PITX2 cause Axenfeld-Rieger syndrome.

Immunogen

The immunogen for anti-PITX2 antibody: synthetic peptide derected towards the N terminal of human PITX2

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jing Luo et al.
Cancer cell international, 19, 96-96 (2019-05-03)
The homeodomain transcription factor, PITX2 is associated with tumorigenesis of multiple cancers. In this research, we aimed to study the expression, function and mechanism of PITX2 in lung adenocarcinoma (LUAD). The TCGA dataset was used to analyze the expression and
J Drouin et al.
Molecular and cellular endocrinology, 140(1-2), 31-36 (1998-08-29)
A subfamily of bicoid-related homeodomain factors was recently discovered through its involvement in transcription of pituitary-specific genes. We isolated the first member of this family, Ptxl (pituitary homeobox 1), through its DNA binding properties whereas a second related gene, Ptx2

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service