Skip to Content
Merck
CN

AV36109

Anti-CREB3L1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-cAMP responsive element binding protein 3-like 1

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

57 kDa

species reactivity

bovine, rat, horse, mouse, human, dog, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CREB3L1(90993)

Immunogen

Synthetic peptide directed towards the N terminal region of human CREB3L1

Biochem/physiol Actions

CREB3L1 is localized to the membrane of endoplasmic reticulum that translocates to the nucleus and acts as transcription factor in the event of cellular stress. It regulates the transcription of arginine vasopressin, a neurohypophysical hormone that maintains hydromineral homeostasis. It reportedly represses the expression of genes involved in metastasis, invasion and angiogenesis and thus suppresses tumorigenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


wgk

WGK 3

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Paul Mellor et al.
Molecular and cellular biology, 33(24), 4985-4995 (2013-10-16)
The unfolded protein response (UPR) is activated in response to hypoxia-induced stress such as in the tumor microenvironment. This study examined the role of CREB3L1 (cyclic AMP [cAMP]-responsive element-binding protein 3-like protein 1), a member of the UPR, in breast
Mingkwan Greenwood et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(11), 3810-3820 (2014-03-14)
Arginine vasopressin (AVP) is a neurohypophysial hormone regulating hydromineral homeostasis. Here we show that the mRNA encoding cAMP responsive element-binding protein-3 like-1 (CREB3L1), a transcription factor of the CREB/activating transcription factor (ATF) family, increases in expression in parallel with AVP