Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
57 kDa
species reactivity
bovine, rat, horse, mouse, human, dog, pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... CREB3L1(90993)
Immunogen
Synthetic peptide directed towards the N terminal region of human CREB3L1
Biochem/physiol Actions
CREB3L1 is localized to the membrane of endoplasmic reticulum that translocates to the nucleus and acts as transcription factor in the event of cellular stress. It regulates the transcription of arginine vasopressin, a neurohypophysical hormone that maintains hydromineral homeostasis. It reportedly represses the expression of genes involved in metastasis, invasion and angiogenesis and thus suppresses tumorigenesis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
wgk
WGK 3
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Paul Mellor et al.
Molecular and cellular biology, 33(24), 4985-4995 (2013-10-16)
The unfolded protein response (UPR) is activated in response to hypoxia-induced stress such as in the tumor microenvironment. This study examined the role of CREB3L1 (cyclic AMP [cAMP]-responsive element-binding protein 3-like protein 1), a member of the UPR, in breast
Mingkwan Greenwood et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(11), 3810-3820 (2014-03-14)
Arginine vasopressin (AVP) is a neurohypophysial hormone regulating hydromineral homeostasis. Here we show that the mRNA encoding cAMP responsive element-binding protein-3 like-1 (CREB3L1), a transcription factor of the CREB/activating transcription factor (ATF) family, increases in expression in parallel with AVP