Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
35 kDa
species reactivity
dog, horse, guinea pig, mouse, human, rat, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... FOXB1(27023)
Looking for similar products? Visit Product Comparison Guide
Immunogen
Synthetic peptide directed towards the N terminal region of human FOXB1
Biochem/physiol Actions
FOXB1 is a winged helix transcription factor that is essential for the differentiation of spinal cord and brain development. It controls the histogenesis of diencephalon and controls the access of mammillothalamic axons to the thalamus as well as lactation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYY
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
P A Labosky et al.
Mechanisms of development, 76(1-2), 185-190 (1998-10-10)
The embryonic neural crest is a unique group of cells that gives rise to the peripheral nervous system as well as many other cell types. Most of the work describing the behavior and specification of these cells has been done
C Dou et al.
Neuron, 18(4), 539-551 (1997-04-01)
Thymocyte winged helix (TWH) is a putative transcription factor expressed in the developing neural tube. At midgestation, TWH expression identifies subsets of spinal cord motor neurons and interneurons. TWH-expressing motor neurons were restricted to specific spinal cord levels, distinguishing motor
G Alvarez-Bolado et al.
Development (Cambridge, England), 127(5), 1029-1038 (2000-02-09)
Our aim was to study the mechanisms of brain histogenesis. As a model, we have used the role of winged helix transcription factor gene Foxb1 in the emergence of a very specific morphological trait of the diencephalon, the mammillary axonal
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service