AV39076
Anti-BRD4 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Bromodomain containing 4, Anti-CAP, Anti-HUNKI, Anti-MCAP
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
80 kDa
species reactivity
rat, rabbit, mouse, canine, human, guinea pig, horse, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... BRD4(23476)
General description
Bromodomain containing 4 (Brd4), a member of the BET family of proteins, has been shown to play important roles in cellular growth control, cell cycle progression, and cancer development. Brd4 is a chromatin adapter molecule crucial for transmitting epigenetic information by acting as a histone acetylation-dependent gene bookmark and accelerating post-mitotic transcriptional reactivation. Bdr4 localizes to chromosomes during mitosis and during interphase it interacts with P-TEFb to function as a global transcriptional coactivator. BRD4, has been identified recently as a therapeutic target in acute myeloid leukemia, multiple myeloma, Burkitt′s lymphoma, NUT midline carcinoma, colon cancer, and inflammatory disease; its loss is a prognostic signature for metastatic breast cancer. BRD4 also contributes to regulation of both cell cycle and transcription of oncogenes, HIV, and human papilloma virus (HPV).
Immunogen
The immunogen for anti-BRD4 antibody: synthetic peptide derected towards the C terminal of human BRD4
Application
Anti-Bromodomain containing 4 polyclonal antibody is used to tag Brd4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Brd4 in cellular growth control, cell cycle progression, and cancer development.
Biochem/physiol Actions
Anti-Bromodomain containing 4 polyclonal antibody reacts with human, mouse, rat, bovine, and canine Brd4 proteins.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
11 - Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Mi-Sun Kang et al.
Cell reports, 29(13), 4632-4645 (2019-12-26)
Proliferating cell nuclear antigen (PCNA) is a DNA clamp essential for DNA replication. During DNA synthesis, PCNA is continuously loaded onto and unloaded from DNA. PCNA recruits various proteins to nascent DNA to facilitate chromosome duplication. Therefore, timely PCNA unloading
Scott R Floyd et al.
Nature, 498(7453), 246-250 (2013-06-04)
DNA damage activates a signalling network that blocks cell-cycle progression, recruits DNA repair factors and/or triggers senescence or programmed cell death. Alterations in chromatin structure are implicated in the initiation and propagation of the DNA damage response. Here we further
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service