Skip to Content
Merck
CN

AV40173

Anti-ACTB antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):

Actb Antibody, Actb Antibody - Anti-ACTB antibody produced in rabbit, Anti-Actin, β, Anti-Beta-actin, Anti-PS1TP5BP1

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

species reactivity

human

technique(s)

western blot: suitable

immunogen sequence

GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... ACTB(60)

General description

Actin, a highly conserved protein, is a major component of both the cytoskeletal and contractile structures in all cell types. It varies in amount, being related to the type of differentiation and to the functional state of cells and tissues. Actin can be found in two different forms of aggregation, the globular or the fibrillar state, and at least six distinct isoforms occur in vertebrates. The actins exhibit over 90% sequence homology, but each isoform has a unique NH2-terminal sequence. The isoforms are comprised of three α actins (skeletal, cardiac, smooth), one β actin (β-non-muscle) and two gamma actins (gamma smooth muscle and gamma non-muscle). Difficulties have been encountered in producing polyclonal antibodies due to the highly conserved nature of actin.

Immunogen

synthetic peptide corresponding to a region of human ACTB with an internal ID of P22019

Application

β-actin is a nonmuscle actin involved in cytoskeletal structures. Anti-ACTB (anti-β-Actin) is a rabbit IgG polyclonal antibody used to tag β-Actin protein(s) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.
Rabbit Anti-ActinB is useful for studying actin structure and function, and to probe binding sites of actin-binding proteins.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

Anti-ACTB (anti-β-Actin) antibody recognizes an internal sequence of human β-actin.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

13 - Non Combustible Solids

wgk

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Lori A Ehrlich et al.
Cell cycle (Georgetown, Tex.), 14(3), 388-398 (2015-02-07)
T-cell acute lymphoblastic leukemia (T-ALL) is a cancer of immature T cells that exhibits heterogeneity of oncogenic lesions, providing an obstacle for development of more effective and less toxic therapies. Inherited deficiency of ATM, a regulator of the cellular DNA
Yueh-Lin Tsai et al.
Scientific reports, 12(1), 8180-8180 (2022-05-18)
Fused in Sarcoma (FUS) is a nuclear RNA/DNA binding protein that mislocalizes to the cytoplasm in the neurodegenerative diseases ALS and FTD. Despite the existence of FUS pathogenic mutations that result in nuclear import defects, a subset of ALS/FTD patients
Megan R Fisher et al.
Journal of immunology (Baltimore, Md. : 1950), 198(7), 2943-2956 (2017-02-19)
Mammalian cells have evolved a common DNA damage response (DDR) that sustains cellular function, maintains genomic integrity, and suppresses malignant transformation. In pre-B cells, DNA double-strand breaks (DSBs) induced at Igκ loci by the Rag1/Rag2 (RAG) endonuclease engage this DDR