Skip to Content
Merck
CN

AV40257

Sigma-Aldrich

Anti-RBMy1A1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-RBM1, Anti-RBM2, Anti-RBMY, Anti-RNA binding motif protein, Y-linked, family 1, member A1, Anti-YRRM1, Anti-YRRM2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

41 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... RBMY1A1(5940)

General description

RNA binding motif protein, γ-linked, family 1, member A1 (RBMy1A1, γRRM1, γRRM2) is a germ-cell specific nuclear RNA-binding protein involves in spermatogenesis. RBMγ binds to RNA stem-loops capped by a C(A)/(U)CAA pentaloops and participates in splicing within the testis by modulating the activity of constitutively expressed splicing factors.

Immunogen

Synthetic peptide directed towards the N terminal region of human RBMY1A1

Application

Anti-RBMy1A1 polyconal antibody is used to tag RNA binding motif protein, γ-linked, family 1, member A1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein, γ-linked, family 1, member A1 in spermatogenesis.

Biochem/physiol Actions

Anti-RBMy1A1 polyconal antibody reacts with chicken, human, mouse, rat, canine, and bovine RNA binding motif protein, γ-linked, family 1, member A1 proteins.
RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service