Skip to Content
Merck
CN

AV40663

Anti-KHDRBS3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-KH domain containing, RNA binding, signal transduction associated 3

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

38 kDa

species reactivity

horse, guinea pig, rat, human, rabbit, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable, western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KHDRBS3(10656)

General description

KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3, SLM-2), a close relative of SAM68, is a member of the RNA binding K homology (KH) and STAR (signal transduction activator of RNA metabolism) protein family. KHDRBS3 is involved in post-transcriptional regulation via RNA binding via U(U/A)AA repeats. KHDRBS3 is a plasma membrane plextrin homology domain recruiting protein.

Immunogen

Synthetic peptide directed towards the C terminal region of human KHDRBS3

Application

Anti-KHDRBS3 polyclonal antibody is used to tag KH domain containing, RNA binding, signal transduction associated 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of KH domain containing, RNA binding, signal transduction associated 3 protein as an RNA binding post-transcription regulator and plasma membrane (PM) recruitment protein.

Biochem/physiol Actions

Anti-KHDRBS3 polyclonal antibody reacts with human, mouse, rat, chicken, and bovine KH domain containing, RNA binding, signal transduction associated 3 proteins.
As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service