Anti-KHDRBS3 antibody produced in rabbit

KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3, SLM-2), a close relative of SAM68, is a member of the RNA binding K homology (KH) and STAR (signal transduction activator of RNA metabolism) protein family. KHDRBS3 is involved in post-transcriptional regulation via RNA binding via U(U/A)AA repeats. KHDRBS3 is a plasma membrane plextrin homology domain recruiting protein.

Synthetic peptide directed towards the C terminal region of human KHDRBS3

Anti-KHDRBS3 polyclonal antibody is used to tag KH domain containing, RNA binding, signal transduction associated 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of KH domain containing, RNA binding, signal transduction associated 3 protein as an RNA binding post-transcription regulator and plasma membrane (PM) recruitment protein.

Anti-KHDRBS3 polyclonal antibody reacts with human, mouse, rat, chicken, and bovine KH domain containing, RNA binding, signal transduction associated 3 proteins.

As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.