Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
53 kDa
species reactivity
mouse, guinea pig, human, horse, bovine, rat, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... RBM45(129831)
General description
RNA binding motif protein 45 (RBM45, DRB1) is a member of the neural RNA recognition motif (RRM)-type neural RNA-binding protein involved in essential roles in neural development. DRB1 possesses a binding preference for poly(C)RNA.
Immunogen
The immunogen for anti-RBM45 antibody: synthetic peptide derected towards the middle region of human RBM45
Application
Anti-RBM45 polyclonal antibody is used to tag RNA binding motif protein 45 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein 45 in poly(C)RNA binding and neural development.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
Anti-RBM45 polyclonal antibody reacts with rat, bovine, human, mouse, rat, and human RNA binding motif protein 45 proteins.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Mahlon Collins et al.
Acta neuropathologica, 124(5), 717-732 (2012-09-21)
RNA-binding protein pathology now represents one of the best characterized pathologic features of amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration patients with TDP-43 or FUS pathology (FTLD-TDP and FTLD-FUS). Using liquid chromatography tandem mass spectrometry, we identified altered levels